LXL04_009239 | RubberDandelionOmics

Gene overview

LXL04_009239

Reference: OH-1004 Chr: Chr02 Coordinates: 121190557-121192312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1461 bp · LXL04_009239|LXL04_009239|OH1004|cDNA

ATGGACGAAGAAGTTATCATTAAACGAAGAAAGGATGCAGCAAGCGGGAATTTGATCATGAGACCTGTGAATTGGATTAGAATGTTGAGCGATGAATTGAGCTGGAGATTTGTTTTAGCCGTCGTGATTGTGTACGGAATCAACCAGGGTACGAGCATTGGTCTGTATCGGGTCAGTGTACAATACTACATGAAAGATGTACAGAAGTTACAACCTTCGGAATCGCAGTTTTACTTTGGGATTATTCAAATTCCATGGAT...

CDS

Download CDS FASTA

1461 bp · LXL04_009239|LXL04_009239|OH1004|CDS

ATGGACGAAGAAGTTATCATTAAACGAAGAAAGGATGCAGCAAGCGGGAATTTGATCATGAGACCTGTGAATTGGATTAGAATGTTGAGCGATGAATTGAGCTGGAGATTTGTTTTAGCCGTCGTGATTGTGTACGGAATCAACCAGGGTACGAGCATTGGTCTGTATCGGGTCAGTGTACAATACTACATGAAAGATGTACAGAAGTTACAACCTTCGGAATCGCAGTTTTACTTTGGGATTATTCAAATTCCATGGAT...

Protein

Download Protein FASTA

486 aa · LXL04_009239|LXL04_009239|OH1004|PROTEIN

MDEEVIIKRRKDAASGNLIMRPVNWIRMLSDELSWRFVLAVVIVYGINQGTSIGLYRVSVQYYMKDVQKLQPSESQFYFGIIQIPWIIKPLWGLMTDIVPIFRLRRRPYFIFAGLIGSIAMLVPAFTTNLSLVWAILFFMTASAGVAIADVTIDACVTENSISHPSLAGDMQSLCGISSSIGQLVGFAISGVLVHIIGPQGVFGVLSIPAGLVILVGFMLEEPLVHGYSHKRVSQKFLDAVKTMVTALKSPDVWRPSLYM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009239`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009239

Location Chr02:121190557-121192312 (+)

Description Similar to At5g25050: Probable folate-biopterin transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25050`	Could mediate folate transport.	No verified direct reference in this release
`At1g79710`	Could mediate folate transport.	No verified direct reference in this release
`At5g25040`	Could mediate folate transport.	No verified direct reference in this release
`At5g10820`	Could mediate folate transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009239 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015884 folic acid transport Biological Process

GO:0015885 5-formyltetrahydrofolate transport Biological Process

GO:0051958 methotrexate transport Biological Process

GO:0098838 folate transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0008517 folic acid transmembrane transporter activity Molecular Function

GO:0015231 5-formyltetrahydrofolate transmembrane transporter activity Molecular Function

GO:0015350 methotrexate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G79710

ath:AT5G10820

ath:AT5G25040

ath:AT5G25050

syn:slr0642

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.436

Rank 1 · LXL04_009239 · OH-1004

Cell membrane0.221

Rank 2 · LXL04_009239 · OH-1004

Endoplasmic reticulum0.160

Rank 3 · LXL04_009239 · OH-1004

Golgi apparatus0.109

Rank 4 · LXL04_009239 · OH-1004

Cytoplasm0.101

Rank 5 · LXL04_009239 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03092.23BT149-451 aa

PF07690.22MFS_152-396 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009239	`PF03092.23`	BT1	49	451	5.2e-118	395.2
LXL04_009239	`PF07690.22`	MFS_1	52	396	7.2e-13	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5FV41`	Arabidopsis thaliana	Probable folate-biopterin transporter 2	58.599%	Swiss-Prot	strong database homology
`Q9SQN2`	Arabidopsis thaliana	Probable folate-biopterin transporter 3	57.563%	Swiss-Prot	strong database homology
`F4KIL8`	Arabidopsis thaliana	Probable folate-biopterin transporter 5	53.638%	Swiss-Prot	strong database homology
`Q9LEV7`	Arabidopsis thaliana	Probable folate-biopterin transporter 6	46.482%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card