TkA03G410010 | RubberDandelionOmics

Gene overview

TkA03G410010

Reference: TK1151 Chr: Chr03 Coordinates: 101950238-101954397 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1710 bp · TkA03G410010|TK1151|cDNA

TCGCAAGGGCGTTCTGGAGGCCTCTTTTGCATTTGGAACCCAAACTTCCTTCACCAGGAAGAAGTGGTGAGATCCGATTATTTCATATTAGTTTCAGGCAGATGCACAGGGGTAGATCATAAGGTGAATCTAGTCAATATTTATGCGCCCATAGACCCAATTGCCAGGCAGGGTCTGTGGTTTGAGCTCTTGGATCTGATGAGTAGATTTGAGGGTGTTTGGTTATTCATGGGGGACTTCAACGAAGTAAGGAGTAGAGA...

CDS

Download CDS FASTA

1710 bp · TkA03G410010|TK1151|CDS

TCGCAAGGGCGTTCTGGAGGCCTCTTTTGCATTTGGAACCCAAACTTCCTTCACCAGGAAGAAGTGGTGAGATCCGATTATTTCATATTAGTTTCAGGCAGATGCACAGGGGTAGATCATAAGGTGAATCTAGTCAATATTTATGCGCCCATAGACCCAATTGCCAGGCAGGGTCTGTGGTTTGAGCTCTTGGATCTGATGAGTAGATTTGAGGGTGTTTGGTTATTCATGGGGGACTTCAACGAAGTAAGGAGTAGAGA...

Protein

Download Protein FASTA

569 aa · TkA03G410010|TK1151|PROTEIN

SQGRSGGLFCIWNPNFLHQEEVVRSDYFILVSGRCTGVDHKVNLVNIYAPIDPIARQGLWFELLDLMSRFEGVWLFMGDFNEVRSREERFSERVCTASMNAFNSFIHKAGLVDFKMGDCLDFGPVPFRFFNSWLRLDEFAEVVTRSWVAPIDGLSPDRLLLKKLQRLKNAIKIWRSQLKNEEGLEKGDLIRQVIDLEAKAEVQPLSSPERRNRMEWRNRIVEIEEIRRRDLKQRAKVKWDIDGDENSRFFHGVVNSHRRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G410010`
TK1151 ID	TkA03G410010
OH-1004 ID	LXL04_014780
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.100
Protein coverage (%)	TK1151 93.322 / OH-1004 26.593 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G410010`
Location	Chr03:101950238-101954397 (+)
Description	Similar to Transposon TX1 uncharacterized 149 kDa protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014780` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006310 DNA recombination Biological Process GO:0006974 DNA damage response Biological Process GO:0010212 response to ionizing radiation Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031297 replication fork processing Biological Process GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process GO:0032197 retrotransposition Biological Process GO:0036297 interstrand cross-link repair Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:2000001 regulation of DNA damage checkpoint Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	hsa:55159 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · TkA03G410010 · TK1151

Nucleus0.335

Rank 2 · TkA03G410010 · TK1151

Cell membrane0.082

Rank 3 · TkA03G410010 · TK1151

Plastid0.072

Rank 4 · TkA03G410010 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA03G410010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_1338-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G410010	`PF00078`	RVT_1	338	462	9e-15	55.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card