TkA03G406690 | RubberDandelionOmics

Gene overview

TkA03G406690

Reference: TK1151 Chr: Chr03 Coordinates: 101102462-101107047 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2184 bp · TkA03G406690|TK1151|cDNA

GTTTTCTTCCATCAGCATAAACAACCAACATCGAGCCTCCACGTTTCCATCATCCCTCGCTCTTATACTCCCTCCTCACCACTCCCTTTCTCTGCAATTCAGCTCCCGTTTTCTTTTCTTCCGACAACGATTGCGCACCGAAAGCCTCTCAAACTGATCGTCGAAAATTAACACAAACTAAATTGGACCTAAAGTTTGAATAAATTCCATCAAGTTTGCCAGCTGGATTAGTCCCATTTATCGTTTCTACACCTTCAAAG...

CDS

Download CDS FASTA

1728 bp · TkA03G406690|TK1151|CDS

ATGGGTGGAGCATGTTCTAGAAAACAAGGCCAACATATAAATGAAGATGGTGCATATAGTCGGCTTTCTAGAAGATATTCCAGAAATGGAAGCTCAAAGTGGCCGGGAACCTCTTTTTATCGAACAACTATTGATGATAAATCAAGAATAGCATTTTGTCCATCTCTCATGGAATTGTGCACTTATATAGTGTGTGAAAAAATTGATGAATATGAGAGCTTGTGTATGCTTCCAAAGGATATTAGCCAGCAAATATTTGA...

Protein

Download Protein FASTA

575 aa · TkA03G406690|TK1151|PROTEIN

MGGACSRKQGQHINEDGAYSRLSRRYSRNGSSKWPGTSFYRTTIDDKSRIAFCPSLMELCTYIVCEKIDEYESLCMLPKDISQQIFDELVYSRRLNATYLEAFRGCALEDIDLGEYPGVDDSWMEVISSQGSSLLTSDFSGSNLTDYALIHIKDCDNIQDLNFNFCAQISDTGLDHISGLSNLTTLSLKRNNSITADGMIALSNLVNLSKLDLERCPLIHGGLVQIKGLSKLEVLNINCCNCITDDDMEPLSELKNLKEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G406690`
TK1151 ID	TkA03G406690
OH-1004 ID	LXL04_009185
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G406690`
Location	Chr03:101102462-101107047 (+)
Description	Similar to FBXL14: F-box/LRR-repeat protein 14
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009185` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0019005 SCF ubiquitin ligase complex Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function
KEGG gene cross-reference	hsa:144699 mmu:101358 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.498

Rank 1 · TkA03G406690 · TK1151

Nucleus0.462

Rank 2 · TkA03G406690 · TK1151

Mitochondrion0.067

Rank 3 · TkA03G406690 · TK1151

Cell membrane0.050

Rank 4 · TkA03G406690 · TK1151

Endoplasmic reticulum0.028

Rank 5 · TkA03G406690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25013LRR_Zer-166-94 aa

PF25019LRR_R13L1-DRL2180-107 aa

PF12586DUF376080-98 aa

PF23952LRR_EndoS85-123 aa

PF29594LRR_SKP2106-183 aa

PF25013LRR_Zer-1133-148 aa

PF25019LRR_R13L1-DRL21136-189 aa

PF12799LRR_4139-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G406690	`PF25013`	LRR_Zer-1	66	94	0.00033	21.5
TkA03G406690	`PF25019`	LRR_R13L1-DRL21	80	107	0.005	17.5
TkA03G406690	`PF12586`	DUF3760	80	98	0.033	15.0
TkA03G406690	`PF23952`	LRR_EndoS	85	123	0.00037	21.4
TkA03G406690	`PF29594`	LRR_SKP2	106	183	3.9e-11	43.4
TkA03G406690	`PF25013`	LRR_Zer-1	133	148	0.00033	21.5
TkA03G406690	`PF25019`	LRR_R13L1-DRL21	136	189	0.005	17.5
TkA03G406690	`PF12799`	LRR_4	139	174	9.1e-24	83.7
TkA03G406690	`PF25372`	LRR_FBXL15	140	216	7.1e-26	91.4
TkA03G406690	`PF27482`	Beta-prop_YycP	153	192	0.12	12.1
TkA03G406690	`PF24758`	LRR_At5g56370	156	216	1.2e-08	35.6
TkA03G406690	`PF13516`	LRR_6	157	175	9.4e-28	94.7
TkA03G406690	`PF23952`	LRR_EndoS	167	215	0.00037	21.4
TkA03G406690	`PF12586`	DUF3760	167	188	0.033	15.0
TkA03G406690	`PF13855`	LRR_8	169	218	2.7e-25	88.6
TkA03G406690	`PF25019`	LRR_R13L1-DRL21	172	240	0.005	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card