TkA03G395080 | RubberDandelionOmics

Gene overview

TkA03G395080

Reference: TK1151 Chr: Chr03 Coordinates: 98125692-98129013 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2654 bp · TkA03G395080|TK1151|cDNA

TTATTACAAACCACAATTTATTGTCAAATTACAGGTGTTGTGAAGTTGGATGGCCACGATATAAGGACATTGCAAGTGAAATGGCTAAGAAGTCAAATGAGCATGGTGGGTCAAGAACCTGTTCTATTTGCAAACACAATTCTAGAAAACATTATGATGGGAAAAGAGAATGCCACCAAGAAAGAGGCTATCACAGCTTGTATTGCATCAAATGCCCACAAATTCATAACTAATTTACCAGAAGGTTATGACACACAAGT...

CDS

Download CDS FASTA

1968 bp · TkA03G395080|TK1151|CDS

GAAGAGTCTATTCCCGTTGGAAAAAAACTAGGTTTTGCAAAAGGTATCGGGATTGGTGTTATATATTTGGTTACATATTCCACATGGGCATTGGCTTTTTGGTACGGATCAATCTTGGTTTCAAAACATGAGTTGTCTGGTGGGTCCGCCATTGCGTGCTTCTTTGGTGTCAATGTTGGTGGCAGGGGTTTGGCTTTATCACTATCTTATTATGCTCAATTTGCTCAAGGGACTGTGGCTGCTAGTAGAGTGTTTGAAGT...

Protein

Download Protein FASTA

655 aa · TkA03G395080|TK1151|PROTEIN

EESIPVGKKLGFAKGIGIGVIYLVTYSTWALAFWYGSILVSKHELSGGSAIACFFGVNVGGRGLALSLSYYAQFAQGTVAASRVFEVIDRIPAIDPYSSMGRKLSGGHGKIEFKNVSFSYPSRPTIPILNSLNLVIPSQKTLALVGASGAGKSTVFALLERFYDPNDGVVKLDGHDIRTLQVKWLRSQMSMVGQEPVLFANTILENIMMGKENATKKEAITACIASNAHKFITNLPEGYDTQVGDRGTQLSGGQKQRIAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G395080`
TK1151 ID	TkA03G395080
OH-1004 ID	LXL04_009047
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.389 / OH-1004 44.559 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G395080

Location Chr03:98125692-98129013 (-)

Description Similar to ABCB19: ABC transporter B family member 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28860`	May participate in brassinosteroid export and related signaling.	TWISTED DWARF1, a unique plasma membrane-anchored immunophilin-like protein, interacts with Arabidopsis multidrug resistance-like transporters AtPGP1 and AtPGP19.2003 · DOI: 10.1091/mbc.e02-10-0698 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 An ATP-Binding Cassette Transporter, ABCB19, Regulates Leaf Position and Morphology during Phototropin1-Mediated Blue Light Responses.2020 · DOI: 10.1104/pp.20.00223 Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 ABCB19 transporter: fostering brassinosteroid transport through membrane flexibility.2024 · DOI: 10.1016/j.tplants.2024.06.005 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181 Quantitative analysis of the root posture of Arabidopsis thaliana mutants with wavy roots.2024 · DOI: 10.1017/qpb.2024.12
`At2g36910`	May participate in brassinosteroid export and related signaling.	Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181
`At1g28010`	ABC transporter B family member 14.	No verified direct reference in this release
`At1g27940`	ABC transporter B family member 13.	No verified direct reference in this release
`At3g62150`	ABC transporter B family member 21.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0190300`	Putative multidrug resistance protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009047 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008361 regulation of cell size Biological Process

GO:0009555 pollen development Biological Process

GO:0009624 response to nematode Biological Process

GO:0009637 response to blue light Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

KEGG gene cross-reference

ath:AT2G36910

ath:AT3G28860

ath:AT4G25960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.492

Rank 1 · TkA03G395080 · TK1151

Lysosome / Vacuole0.238

Rank 2 · TkA03G395080 · TK1151

Endoplasmic reticulum0.136

Rank 3 · TkA03G395080 · TK1151

Cytoplasm0.117

Rank 4 · TkA03G395080 · TK1151

Golgi apparatus0.075

Rank 5 · TkA03G395080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane7-58 aa

PF13858DUF41999-36 aa

PF00005ABC_tran129-278 aa

PF03193RsgA_GTPase136-159 aa

PF02463SMC_N139-157 aa

PF13401AAA_22139-176 aa

PF13555AAA_29139-156 aa

PF09818ABC_ATPase140-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G395080	`PF00664`	ABC_membrane	7	58	3.3e-47	162.2
TkA03G395080	`PF13858`	DUF4199	9	36	2.1	9.4
TkA03G395080	`PF00005`	ABC_tran	129	278	4.9e-33	115.4
TkA03G395080	`PF03193`	RsgA_GTPase	136	159	0.11	13.0
TkA03G395080	`PF02463`	SMC_N	139	157	2.2e-08	34.5
TkA03G395080	`PF13401`	AAA_22	139	176	0.012	16.6
TkA03G395080	`PF13555`	AAA_29	139	156	0.055	14.0
TkA03G395080	`PF09818`	ABC_ATPase	140	161	0.00059	19.7
TkA03G395080	`PF13175`	AAA_15	141	180	0.023	15.0
TkA03G395080	`PF01583`	APS_kinase	141	179	0.072	13.8
TkA03G395080	`PF13304`	AAA_21	143	167	1.2e-06	29.5
TkA03G395080	`PF06414`	Zeta_toxin	143	180	0.00012	22.3
TkA03G395080	`PF13858`	DUF4199	188	210	2.1	9.4
TkA03G395080	`PF02463`	SMC_N	194	321	2.2e-08	34.5
TkA03G395080	`PF09818`	ABC_ATPase	225	281	0.00059	19.7
TkA03G395080	`PF13304`	AAA_21	249	297	1.2e-06	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJX0`	Arabidopsis thaliana	sp\|Q9LJX0\|AB19B_ARATH ABC transporter B family member 19	41.700%	Swiss-Prot	Medium
`Q9ZR72`	Arabidopsis thaliana	sp\|Q9ZR72\|AB1B_ARATH ABC transporter B family member 1	40.700%	Swiss-Prot	Medium
`Q9C7F2`	Arabidopsis thaliana	sp\|Q9C7F2\|AB14B_ARATH ABC transporter B family member 14	40.500%	Swiss-Prot	Medium
`Q9C7F8`	Arabidopsis thaliana	sp\|Q9C7F8\|AB13B_ARATH ABC transporter B family member 13	40.100%	Swiss-Prot	Medium
`Q9M1Q9`	Arabidopsis thaliana	sp\|Q9M1Q9\|AB21B_ARATH ABC transporter B family member 21	37.600%	Swiss-Prot	Medium
`Q6YUU5`	Oryza sativa subsp. japonica	sp\|Q6YUU5\|MDR_ORYSJ Putative multidrug resistance protein	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card