TkA03G392470 | RubberDandelionOmics

Gene overview

TkA03G392470

Reference: TK1151 Chr: Chr03 Coordinates: 97313477-97314379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

461 bp · TkA03G392470|TK1151|cDNA

TTAGTGAAAGACTTGTGACTGCCAGTCGCCCTGCAATTGGCCTAATGTTCAAGCAGACACTCGATGTGCTGTTACAAATCCTTGTGATCTTTCCAAAAGTAGAAACCTTGCGCTCCAAGGTCACCTCATTTATTCACCGCATGGTAGAAACATTAGGATCATCTGTCTTTCCATACCTTCCAAAAGCATTAGAGCAACTCCTTTCTGAAAGCGAGCCAAAAGAACTTGTGGGATTCCTTGTATTAATCAACCAACTAATA...

CDS

Download CDS FASTA

417 bp · TkA03G392470|TK1151|CDS

ATGTTCAAGCAGACACTCGATGTGCTGTTACAAATCCTTGTGATCTTTCCAAAAGTAGAAACCTTGCGCTCCAAGGTCACCTCATTTATTCACCGCATGGTAGAAACATTAGGATCATCTGTCTTTCCATACCTTCCAAAAGCATTAGAGCAACTCCTTTCTGAAAGCGAGCCAAAAGAACTTGTGGGATTCCTTGTATTAATCAACCAACTAATATGCAAATTCAATACATCTGTCCAAGATATTCTAGAAAATGAAAT...

Protein

Download Protein FASTA

139 aa · TkA03G392470|TK1151|PROTEIN

MFKQTLDVLLQILVIFPKVETLRSKVTSFIHRMVETLGSSVFPYLPKALEQLLSESEPKELVGFLVLINQLICKFNTSVQDILENEIRELQELQRTFYTFLHVVATHGLSSVFLSAKSRVYLDPMMQLLLFTCCNHKDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G392470`
TK1151 ID	TkA03G392470
OH-1004 ID	LXL04_009008
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.700
Protein coverage (%)	TK1151 100.000 / OH-1004 16.785 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G392470

Location Chr03:97313477-97314379 (-)

Description Similar to PSD: Exportin-T

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72560`	Probable tRNA nucleus export receptor which regulates tRNA processing and facilitates tRNA translocation across the nuclear pore complex.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0613300`	Probable tRNA nucleus export receptor which regulates tRNA processing and facilitates tRNA translocation across the nuclear pore complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009008 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006409 tRNA export from nucleus Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0008033 tRNA processing Biological Process

GO:0009908 flower development Biological Process

GO:0010014 meristem initiation Biological Process

GO:0071528 tRNA re-export from nucleus Biological Process

GO:0005643 nuclear pore Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016363 nuclear matrix Cellular Component

GO:0000049 tRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G72560

dosa:Os07g0613300

hsa:11260

pon:100172757

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.714

Rank 1 · TkA03G392470 · TK1151

Cytoplasm0.419

Rank 2 · TkA03G392470 · TK1151

Endoplasmic reticulum0.033

Rank 3 · TkA03G392470 · TK1151

Cell membrane0.028

Rank 4 · TkA03G392470 · TK1151

Mitochondrion0.026

Rank 5 · TkA03G392470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19282Exportin-T2-85 aa

PF19282Exportin-T89-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G392470	`PF19282`	Exportin-T	2	85	2e-16	60.0
TkA03G392470	`PF19282`	Exportin-T	89	138	2e-16	60.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC79`	Arabidopsis thaliana	sp\|Q7PC79\|XPOT_ARATH Exportin-T	65.700%	Swiss-Prot	High
`Q8H3A7`	Oryza sativa subsp. japonica	sp\|Q8H3A7\|XPOT_ORYSJ Exportin-T	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card