Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2970 bp · LXL04_009008|LXL04_009008|OH1004|cDNA
ATGGACGATCTGGAGAAGGCGATACTCATCATCTTCGATGAATCGGGGACAGTTACATCTGTATTGAAATCACAAGCAGTTGCATTCTGTCAACAAATCAAAGATAATCCATCAATCTGTCGTATATGTATTGAACGATTGTGCTTCTCGAAACTCGTTCAAGTTCAGTTTTGGTGTTTACAATGTTTGCATGAAGTTTTACGCTCTCGCTACTCCGGAATGAGCACAGACGAGAAATCCTTCGTTAGGACATCGGTTTT...
2970 bp · LXL04_009008|LXL04_009008|OH1004|CDS
ATGGACGATCTGGAGAAGGCGATACTCATCATCTTCGATGAATCGGGGACAGTTACATCTGTATTGAAATCACAAGCAGTTGCATTCTGTCAACAAATCAAAGATAATCCATCAATCTGTCGTATATGTATTGAACGATTGTGCTTCTCGAAACTCGTTCAAGTTCAGTTTTGGTGTTTACAATGTTTGCATGAAGTTTTACGCTCTCGCTACTCCGGAATGAGCACAGACGAGAAATCCTTCGTTAGGACATCGGTTTT...
Protein
Download Protein FASTA989 aa · LXL04_009008|LXL04_009008|OH1004|PROTEIN
MDDLEKAILIIFDESGTVTSVLKSQAVAFCQQIKDNPSICRICIERLCFSKLVQVQFWCLQCLHEVLRSRYSGMSTDEKSFVRTSVFSMACYETLDNSNSVKVLDGPPYVKNKLAQVLVTLIYFEYPSIWSSIFLDFLPNLSKGGVVIDMFCRVLNALDDELISQDYPRTPEQGAVSGKIKDAMRQQCVNQIVHAWYDIISLYKSTDSELCAFVLDTMRRYISWIEIALVANNTFLPLLFELMLVDGLPDQLRSAACGCV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009008 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009008 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:115890399-115894465 (-) | ||||||||||||
| Description | Similar to PSD: Exportin-T | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006409 tRNA export from nucleus Biological Process GO:0006886 intracellular protein transport Biological Process GO:0008033 tRNA processing Biological Process GO:0009908 flower development Biological Process GO:0010014 meristem initiation Biological Process GO:0071528 tRNA re-export from nucleus Biological Process GO:0005643 nuclear pore Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016363 nuclear matrix Cellular Component GO:0000049 tRNA binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G72560 dosa:Os07g0613300 hsa:11260 pon:100172757 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08389.19Xpo1107-260 aaPF19282.6Exportin-T325-977 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009008 | PF08389.19 | Xpo1 | 107 | 260 | 8.6e-36 | 123.9 |
| LXL04_009008 | PF19282.6 | Exportin-T | 325 | 977 | 7.4e-91 | 306.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.