TkA03G385440 | RubberDandelionOmics

Gene overview

TkA03G385440

Reference: TK1151 Chr: Chr03 Coordinates: 95367761-95369718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

879 bp · TkA03G385440|TK1151|cDNA

ATGCGAGGTGAAGAAGAAAGATGGCACCGGCGGGTAAATGGAGCTCGGGCTCAGCGTGACGACGACACCGTAGGAGTTTGGGTTCAGAAAGATGAGCGGCTTCGCGGGACTCGCACACGGTCAGACAGATGCGATAAGGTCACGAAACTATGCGATTTGGGTATCGACAAAACCGTGTGTTCAGTTTCTTGGTCACAACAAGGAACAACTCTCGCAGTCGGTACCAGCAATGGAGAAGTCCAGATATGGGACGTGTTTGG...

CDS

Download CDS FASTA

879 bp · TkA03G385440|TK1151|CDS

ATGCGAGGTGAAGAAGAAAGATGGCACCGGCGGGTAAATGGAGCTCGGGCTCAGCGTGACGACGACACCGTAGGAGTTTGGGTTCAGAAAGATGAGCGGCTTCGCGGGACTCGCACACGGTCAGACAGATGCGATAAGGTCACGAAACTATGCGATTTGGGTATCGACAAAACCGTGTGTTCAGTTTCTTGGTCACAACAAGGAACAACTCTCGCAGTCGGTACCAGCAATGGAGAAGTCCAGATATGGGACGTGTTTGG...

Protein

Download Protein FASTA

292 aa · TkA03G385440|TK1151|PROTEIN

MRGEEERWHRRVNGARAQRDDDTVGVWVQKDERLRGTRTRSDRCDKVTKLCDLGIDKTVCSVSWSQQGTTLAVGTSNGEVQIWDVFGCKKLRSMEDFLNLFDLEVLLLNNNGFTGAIPTEAYLSNPLLCHLNAEISEFNESREKELPLIQEVDIKIKELRQMISALNNQQMSLKAAFRKKKDAVKEMDEKISSAEFALVQSAQENASLRSKIVQSPVKLQRALEEKKAVLIESKNAERESMQSFQIINFVISRAYRVTDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G385440`
TK1151 ID	TkA03G385440
OH-1004 ID	LXL04_039697
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G385440

Location Chr03:95367761-95369718 (+)

Description Similar to NUF2: Kinetochore protein NUF2 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61000`	Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.	MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823
`At4g11920`	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856 APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
`At4g22910`	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856 FZR2/CCS52A1 expression is a determinant of endoreduplication and cell expansion in Arabidopsis.2009 · DOI: 10.1104/pp.108.132449 APC/C-CCS52A complexes control meristem maintenance in the Arabidopsis root.2009 · DOI: 10.1073/pnas.0901193106
`At5g13840`	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C).	Arabidopsis anaphase-promoting complexes: multiple activators and wide range of substrates might keep APC perpetually busy.2005 · DOI: 10.4161/cc.4.8.1856

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039697 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009624 response to nematode Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009877 nodulation Biological Process

GO:0010091 trichome branching Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G61000

ath:AT4G11920

ath:AT4G22910

ath:AT5G13840

mtr:25493638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.484

Rank 1 · TkA03G385440 · TK1151

Cytoplasm0.394

Rank 2 · TkA03G385440 · TK1151

Cell membrane0.093

Rank 3 · TkA03G385440 · TK1151

Mitochondrion0.063

Rank 4 · TkA03G385440 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA03G385440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24105Beta-prop_CAF1B_HIR119-96 aa

PF24814WD40_Prp1920-48 aa

PF25175Beta-prop_WDR520-95 aa

PF25047Beta-prop_TEP1_2nd20-86 aa

PF24817WD40_WDHD1_1st44-94 aa

PF24807WD40_CDC20-Fz45-95 aa

PF12894ANAPC4_WD4046-91 aa

PF24814WD40_Prp1946-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G385440	`PF24105`	Beta-prop_CAF1B_HIR1	19	96	0.042	13.5
TkA03G385440	`PF24814`	WD40_Prp19	20	48	0.00034	20.5
TkA03G385440	`PF25175`	Beta-prop_WDR5	20	95	0.0013	18.8
TkA03G385440	`PF25047`	Beta-prop_TEP1_2nd	20	86	0.08	12.8
TkA03G385440	`PF24817`	WD40_WDHD1_1st	44	94	1.7e-05	24.9
TkA03G385440	`PF24807`	WD40_CDC20-Fz	45	95	7e-10	39.4
TkA03G385440	`PF12894`	ANAPC4_WD40	46	91	3.4e-05	24.7
TkA03G385440	`PF24814`	WD40_Prp19	46	114	0.00034	20.5
TkA03G385440	`PF23389`	Beta-prop_WDR19_1st	48	90	0.00044	20.1
TkA03G385440	`PF23098`	Beta-prop_NOL10_N	52	85	0.0014	18.5
TkA03G385440	`PF23414`	Beta-prop_EML_2	52	85	0.0074	16.4
TkA03G385440	`PF23775`	Beta-prop_RIG_2nd	53	92	0.0034	17.6
TkA03G385440	`PF23381`	Beta-prop_IFT122_1st	56	87	1.3e-05	25.4
TkA03G385440	`PF25174`	Beta-prop_THOC3	56	89	0.00053	19.8
TkA03G385440	`PF24805`	EIF3I	56	95	0.26	11.1
TkA03G385440	`PF00400`	WD40	57	84	0.00065	20.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXJ0`	Arabidopsis thaliana	sp\|Q8RXJ0\|NUF2_ARATH Kinetochore protein NUF2 homolog	55.900%	Swiss-Prot	Low
`Q8VZS9`	Arabidopsis thaliana	sp\|Q8VZS9\|FZR1_ARATH Protein FIZZY-RELATED 1	70.000%	Swiss-Prot	Low
`Q8L3Z8`	Arabidopsis thaliana	sp\|Q8L3Z8\|FZR2_ARATH Protein FIZZY-RELATED 2	66.000%	Swiss-Prot	Low
`Q8LPL5`	Arabidopsis thaliana	sp\|Q8LPL5\|FZR3_ARATH Protein FIZZY-RELATED 3	55.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card