TkA03G383620 | RubberDandelionOmics

Gene overview

TkA03G383620

Reference: TK1151 Chr: Chr03 Coordinates: 94766776-94768465 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1606 bp · TkA03G383620|TK1151|cDNA

TTGCTCTTCTGTATATATAAAATACATCATCAATGAGCATACATCCATGCTCTAAAAATAGTCTCCTATAATTCATTGATTTTTCCATTCTCTTCTTCTTCTTCTCCAACTTCCATCCTCTTTAGAGATTGTTGCCGTAATTTCTTCTTCAATCTTTTATTCTACTAGTATTCACTTCTTTTAGTCGGGAAATTAATCTGAGTAGTTATGGAAGATTTGGGCTGGGAAAGAAACATGTTGTCGTTTCCATGGAGCAACTC...

CDS

Download CDS FASTA

1158 bp · TkA03G383620|TK1151|CDS

ATGGAAGATTTGGGCTGGGAAAGAAACATGTTGTCGTTTCCATGGAGCAACTCCAATAATCATCAGCAGCAGCAGCAAGACATCGGGAAAAGCTTCGTTTTTGGTTCAGACAATAGCATCCTAGATCACTTAACAGCTGCAGGCGGCCGTCAAATGGGTTCTCATCCGTTAGCACCGGCGAGGATAGATTCCACTAATGTACCCTCAAGTTTCGGTACTGCTAGTCAATATTGGTCTCAAGGGATGGTTGTCAATGGTTT...

Protein

Download Protein FASTA

385 aa · TkA03G383620|TK1151|PROTEIN

MEDLGWERNMLSFPWSNSNNHQQQQQDIGKSFVFGSDNSILDHLTAAGGRQMGSHPLAPARIDSTNVPSSFGTASQYWSQGMVVNGFHEGKNVIPITTAATDHPGVATAVVAVNSLESLDCLLSTTNSNGADTSPDHEDGISVIFSDYNNLCNDNVLFTNNNNLSGVSSGDSITKEIDDGIVSKCSSDKRRKGFYDDNPSKPKKPRSDPGLPTSSNINFRQTMDSDEPDSEAIAQMKEMIYRAAAFRPVSFADEEAVEKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G383620`
TK1151 ID	TkA03G383620
OH-1004 ID	LXL04_008332
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G383620

Location Chr03:94766776-94768465 (-)

Description Similar to BHLH87: Transcription factor bHLH87

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21330`	Transcription factor bHLH87.	No verified direct reference in this release
`At3g50330`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At5g67060`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At4g00120`	Transcription regulator required for seed dispersal.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0541400`	Transcription factor involved in the negative regulation of flowering.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008332 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010500 transmitting tissue development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048462 carpel formation Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0048587 regulation of short-day photoperiodism, flowering Biological Process

GO:0080126 ovary septum development Biological Process

KEGG gene cross-reference

ath:AT3G21330

ath:AT3G50330

ath:AT4G00120

ath:AT5G67060

dosa:Os05g0541400

osa:9269440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · TkA03G383620 · TK1151

Cytoplasm0.080

Rank 2 · TkA03G383620 · TK1151

Cell membrane0.029

Rank 3 · TkA03G383620 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA03G383620 · TK1151

Plastid0.013

Rank 5 · TkA03G383620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH275-317 aa

PF23177bHLH_IRO3277-330 aa

PF23173bHLH_SAC51278-319 aa

PF23176bHLH_LHW280-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G383620	`PF00010`	HLH	275	317	2.6e-06	27.8
TkA03G383620	`PF23177`	bHLH_IRO3	277	330	0.16	13.1
TkA03G383620	`PF23173`	bHLH_SAC51	278	319	5.1e-10	39.8
TkA03G383620	`PF23176`	bHLH_LHW	280	322	0.018	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S3D2`	Arabidopsis thaliana	sp\|Q8S3D2\|BH087_ARATH Transcription factor bHLH87	50.200%	Swiss-Prot	Medium
`Q9SND4`	Arabidopsis thaliana	sp\|Q9SND4\|HEC2_ARATH Transcription factor HEC2	64.900%	Swiss-Prot	Low
`Q9FHA7`	Arabidopsis thaliana	sp\|Q9FHA7\|HEC1_ARATH Transcription factor HEC1	66.700%	Swiss-Prot	Low
`O81313`	Arabidopsis thaliana	sp\|O81313\|IND_ARATH Transcription factor IND	59.400%	Swiss-Prot	Low
`A0A0P0WQ90`	Oryza sativa subsp. japonica	sp\|A0A0P0WQ90\|LF_ORYSJ Transcription factor LATE FLOWERING	56.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card