TkA03G382800 | RubberDandelionOmics

Gene overview

TkA03G382800

Reference: TK1151 Chr: Chr03 Coordinates: 94503672-94506639 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2160 bp · TkA03G382800|TK1151|cDNA

TTTATAAGTCCAATTTTTCAATTCCTCTGCAGTTTAGGAGGTAACCGACCCGTCCTTGTTAACTTTTTACACACTCTGCGAGAAAGACGGTGTAGAAGAAGCAGGAAACCCGAGGCGGCGGCCGGAGCGATCTCATCTCCGGGTCATACACAGGTTGCCATAGGCTATCCAGATAGTTTAGTAAACCGAAAATGTTTATGAAAACCAGGTGGCTGATATTTGACAGGCAACTGAAGAGATCCAATTCTAAGAAGCTGTTA...

CDS

Download CDS FASTA

1740 bp · TkA03G382800|TK1151|CDS

ATGTTTATGAAAACCAGGTGGCTGATATTTGACAGGCAACTGAAGAGATCCAATTCTAAGAAGCTGTTAATTATCAACAGGAAGAAGCAAAAAACAGACCATTCATCTAAGATCCAAAACAAGAAAGGTAATTCAAGTAATAGACCAATCAAAACTCACAGGAATTCAAAGAGAAAGCTTTCCTCCATCTCGAGAAAAGTAATCAGCAAAAGAAAGAAACGAAAAATGGAAAAGGCTGATAAAGTAGATGAACCCATCGA...

Protein

Download Protein FASTA

579 aa · TkA03G382800|TK1151|PROTEIN

MFMKTRWLIFDRQLKRSNSKKLLIINRKKQKTDHSSKIQNKKGNSSNRPIKTHRNSKRKLSSISRKVISKRKKRKMEKADKVDEPIDRISELPEPIIHHILSLLNCPRDVARITALSKKWKSIWASFFFFQFDEKRFNSSKKDGGEKFMNFVDTSLSTKLIPMDTIHKFKISLSQTNTKLNLSMYRWLNSAINKNVKELEIHIEEKKKRLYKLPNFILTTNTLTSLRLYGCTFDNEANIDLQNLKQLSIKKSYVNTDVIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G382800`
TK1151 ID	TkA03G382800
OH-1004 ID	LXL04_008326
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G382800

Location Chr03:94503672-94506639 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56400`	Putative FBD-associated F-box protein At5g56400.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At5g44950`	Putative F-box/FBD/LRR-repeat protein At5g44950.	No verified direct reference in this release
`At3g58920`	Putative F-box/LRR-repeat protein At3g58920.	No verified direct reference in this release
`At1g61330`	Putative FBD-associated F-box protein At1g61330.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008326 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT1G51370

ath:AT3G59200

ath:AT4G00320

ath:AT5G22730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.938

Rank 1 · TkA03G382800 · TK1151

Cytoplasm0.095

Rank 2 · TkA03G382800 · TK1151

Cell membrane0.033

Rank 3 · TkA03G382800 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA03G382800 · TK1151

Plastid0.012

Rank 5 · TkA03G382800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like89-123 aa

PF00646F-box89-130 aa

PF23622LRR_At1g61320_AtMIF1166-322 aa

PF24758LRR_At5g56370186-340 aa

PF23622LRR_At1g61320_AtMIF1328-443 aa

PF24758LRR_At5g56370332-405 aa

PF00646F-box508-519 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G382800	`PF12937`	F-box-like	89	123	2.8e-05	24.5
TkA03G382800	`PF00646`	F-box	89	130	0.00032	21.2
TkA03G382800	`PF23622`	LRR_At1g61320_AtMIF1	166	322	2.3e-29	103.7
TkA03G382800	`PF24758`	LRR_At5g56370	186	340	7.9e-20	72.2
TkA03G382800	`PF23622`	LRR_At1g61320_AtMIF1	328	443	2.3e-29	103.7
TkA03G382800	`PF24758`	LRR_At5g56370	332	405	7.9e-20	72.2
TkA03G382800	`PF00646`	F-box	508	519	0.00032	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM91`	Arabidopsis thaliana	sp\|Q9FM91\|FBD23_ARATH Putative FBD-associated F-box protein At5g56400	21.900%	Swiss-Prot	Low
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	24.700%	Swiss-Prot	Low
`Q9FLA2`	Arabidopsis thaliana	sp\|Q9FLA2\|FDL34_ARATH Putative F-box/FBD/LRR-repeat protein At5g44950	23.400%	Swiss-Prot	Low
`Q9LXR0`	Arabidopsis thaliana	sp\|Q9LXR0\|FBL58_ARATH Putative F-box/LRR-repeat protein At3g58920	28.400%	Swiss-Prot	Low
`O64787`	Arabidopsis thaliana	sp\|O64787\|FBD4_ARATH Putative FBD-associated F-box protein At1g61330	23.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card