TkA03G382010 | RubberDandelionOmics

Gene overview

TkA03G382010

Reference: TK1151 Chr: Chr03 Coordinates: 94248457-94250362 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

817 bp · TkA03G382010|TK1151|cDNA

CAAAACGACAACGCATAAGAACTGCCAGGTGTCGACGAAAATGCACCTGAAACCAAAAATATCTGCCGACCCTTCCTCTCCGATACTTCTCCCTGTGATTTACCACTAAAGCGACGAACATGAATAGTAACATACCTCCACCGCCTCATTCAAGATATTTATCAAACACCTTGTCTGCACTCCATACCTATATATATGGACCAAGTCTTCCATAACTCCTCACCGACCATTTTCATTCACATATTCTTCATTTCAATCCA...

CDS

Download CDS FASTA

558 bp · TkA03G382010|TK1151|CDS

ATGGATCGTCCCTATAAACGCTCGCTTTCATCTTCTTCGTATCGCCCACAAGGTTCTCATCCGTTACGATTCGAAAACGAAGTCGTAGAATTTGATGATGGAGATGTTCCCCAACCCCTTGATTGCTTAATCGGGACACCAATCCCACCGTTTTTGTCAAAAACTTACGATTTGGTGGATGATCCACGATTAGACCAGATCATATCATGGGGCAATCATGGTGCAAGCTTCATTGTGAGGGACCCAGTGGAGTTCGCAAG...

Protein

Download Protein FASTA

186 aa · TkA03G382010|TK1151|PROTEIN

MDRPYKRSLSSSSYRPQGSHPLRFENEVVEFDDGDVPQPLDCLIGTPIPPFLSKTYDLVDDPRLDQIISWGNHGASFIVRDPVEFARVILPRNFKHNNLSSFVRQLNTYGFRKIDTDRWEFACESFLQGKRHLLKNIKRRKTEWNSNPNSNSNSNSNSISIESEVEILQKEKKEMMQEVIKLQQQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G382010`
TK1151 ID	TkA03G382010
OH-1004 ID	LXL04_005053
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 100.000 / OH-1004 48.148 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G382010

Location Chr03:94248457-94250362 (+)

Description Similar to HSFA3: Heat stress transcription factor A-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03720`	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	A cascade of transcription factor DREB2A and heat stress transcription factor HsfA3 regulates the heat stress response of Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2007.03334.x Functional analysis of an Arabidopsis heat-shock transcription factor HsfA3 in the transcriptional cascade downstream of the DREB2A stress-regulatory system.2008 · DOI: 10.1016/j.bbrc.2008.01.134
`At3g22830`	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0161900`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os10g0419300`	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE).	Isolation and characterization of a cDNA encoding two novel heat-shock factor OsHSF6 and OsHSF12 in Oryza sativa L.2005 · DOI: 10.5483/bmbrep.2005.38.5.602
`Os03g0795900`	Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE).	Expression of rice heat stress transcription factor OsHsfA2e enhances tolerance to environmental stresses in transgenic Arabidopsis.2008 · DOI: 10.1007/s00425-007-0670-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G03720

dosa:Os02g0527300

dosa:Os03g0795900

dosa:Os07g0178600

dosa:Os10g0419300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · TkA03G382010 · TK1151

Cytoplasm0.156

Rank 2 · TkA03G382010 · TK1151

Cell membrane0.019

Rank 3 · TkA03G382010 · TK1151

Mitochondrion0.012

Rank 4 · TkA03G382010 · TK1151

Plastid0.010

Rank 5 · TkA03G382010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447HSF_DNA-bind51-140 aa

PF00447HSF_DNA-bind165-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G382010	`PF00447`	HSF_DNA-bind	51	140	4.5e-29	101.6
TkA03G382010	`PF00447`	HSF_DNA-bind	165	176	4.5e-29	101.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYY1`	Arabidopsis thaliana	sp\|Q8GYY1\|HSFA3_ARATH Heat stress transcription factor A-3	59.900%	Swiss-Prot	High
`Q9LUH8`	Arabidopsis thaliana	sp\|Q9LUH8\|HFA6B_ARATH Heat stress transcription factor A-6b	54.200%	Swiss-Prot	High
`Q8H7Y6`	Oryza sativa subsp. japonica	sp\|Q8H7Y6\|HFA2D_ORYSJ Heat stress transcription factor A-2d	63.600%	Swiss-Prot	Medium
`Q338B0`	Oryza sativa subsp. japonica	sp\|Q338B0\|HFA2C_ORYSJ Heat stress transcription factor A-2c	62.800%	Swiss-Prot	Medium
`Q6F388`	Oryza sativa subsp. japonica	sp\|Q6F388\|HFA2E_ORYSJ Heat stress transcription factor A-2e	50.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card