RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G372400
Reference: TK1151 Chr: Chr03 Coordinates: 91887261-91892303 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3432 bp · TkA03G372400|TK1151|cDNA

GCTGGTAGTATAGTATAGTAGATGACAGTGAGGGGAAGTAAAGTGAAAACAGATTAAAGCATAAAAAACAGCAAATGAGCCAACAACAACAACACCTCCCACCCAGTCCATCATATCCATCTACAGTCCTAAACCACTAAATTTACTCCTATACTCTATCCTCTCTCCTTTTAACGATTAGGGTTCCTAAAAAGCTCATAAAAATTCTATCTTTTTCTGTCTCAGAATCTCCTCGTAAGATCTCCTATTTACTTCCTATC...

CDS

Download CDS FASTA

2514 bp · TkA03G372400|TK1151|CDS

ATGATGATGGCGATGTCATGCAAGGATGGTAAGGGGGGAATACTCGACAACGGAAAGTATGTCCGGTACACACCGGAGCAAGTCGAAGCCCTTGAGAGGCTCTACCACGAGTGCCCGAAGCCGACTTCAATTCGTCGTCAACAGCTCATTCGCGATTGCCCTATTCTCTCTAACATTGAGCCTAAACAGATTAAGGTTTGGTTCCAGAATCGAAGATGCAGAGAGAAACAGAGGAGAGAGGCTTCACGCCTTCAAGGCGT...

Protein

Download Protein FASTA

837 aa · TkA03G372400|TK1151|PROTEIN

MMMAMSCKDGKGGILDNGKYVRYTPEQVEALERLYHECPKPTSIRRQQLIRDCPILSNIEPKQIKVWFQNRRCREKQRREASRLQGVNRKLSAMNKLLMEENDRLQKQVSHLVYENGCFRQHTQNTTLPSKDTSCESVVTSHLTQNPPQDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSIGIVAISHGCTGVAARACGLVSLEPTRVAEILKDRPSWFRDCRAVDIVNVLPTANGGTIELLYMQLYAPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G372400
TK1151 IDTkA03G372400
OH-1004 IDLXL04_002118
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)85.500
Protein coverage (%)TK1151 99.761 / OH-1004 99.881
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G372400
LocationChr03:91887261-91892303 (+)
DescriptionSimilar to ATHB-15: Homeobox-leucine zipper protein ATHB-15
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g52150 Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation.
Mutations in the microRNA complementarity site of the INCURVATA4 gene perturb meristem function and adaxialize lateral organs in arabidopsis.2006 · DOI: 10.1104/pp.106.077149
At4g32880 Probable transcription factor involved in the regulation of vascular development.
The arabidopsis ATHB-8 HD-zip protein acts as a differentiation-promoting transcription factor of the vascular meristems.2001 · DOI: 10.1104/pp.126.2.643

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XK30 Probable transcription factor. No verified direct reference in this release
Os03g0640800 Probable transcription factor. No verified direct reference in this release
UniProt: A2ZMN9 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002118 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0008284 positive regulation of cell population proliferation Biological Process
GO:0009733 response to auxin Biological Process
GO:0009855 determination of bilateral symmetry Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010014 meristem initiation Biological Process
GO:0010067 procambium histogenesis Biological Process
GO:0010072 primary shoot apical meristem specification Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010089 xylem development Biological Process
KEGG gene cross-reference
ath:AT1G52150
ath:AT4G32880
dosa:Os03g0640800
dosa:Os12g0612700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.618
Rank 1 · TkA03G372400 · TK1151
Cytoplasm0.318
Rank 2 · TkA03G372400 · TK1151
Cell membrane0.101
Rank 3 · TkA03G372400 · TK1151
Endoplasmic reticulum0.054
Rank 4 · TkA03G372400 · TK1151
Plastid0.043
Rank 5 · TkA03G372400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain19-77 aa
PF05920Homeobox_KN39-74 aa
PF30681ZPR65-118 aa
PF07765KIP167-109 aa
PF00170bZIP_171-112 aa
PF25785TPR82-133 aa
PF24237INO80E104-123 aa
PF01852START159-367 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G372400PF00046Homeodomain19772.2e-1556.9
TkA03G372400PF05920Homeobox_KN39740.1113.1
TkA03G372400PF30681ZPR651180.02815.5
TkA03G372400PF07765KIP1671090.3111.9
TkA03G372400PF00170bZIP_1711120.01915.7
TkA03G372400PF25785TPR821330.1513.1
TkA03G372400PF24237INO80E1041230.1712.9
TkA03G372400PF01852START1593675.2e-50170.4
TkA03G372400PF08670MEKHLA6978367.5e-46156.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZU11Arabidopsis thalianasp|Q9ZU11|ATB15_ARATH Homeobox-leucine zipper protein ATHB-1581.800%Swiss-ProtHigh
Q39123Arabidopsis thalianasp|Q39123|ATHB8_ARATH Homeobox-leucine zipper protein ATHB-875.800%Swiss-ProtHigh
A2XK30Oryza sativa subsp. indicasp|A2XK30|HOX32_ORYSI Homeobox-leucine zipper protein HOX3269.600%Swiss-ProtHigh
Q6AST1Oryza sativa subsp. japonicasp|Q6AST1|HOX32_ORYSJ Homeobox-leucine zipper protein HOX3269.600%Swiss-ProtHigh
A2ZMN9Oryza sativa subsp. indicasp|A2ZMN9|HOX33_ORYSI Homeobox-leucine zipper protein HOX3367.600%Swiss-ProtHigh

JBrowse

View in Genome Browser