LXL04_002118 | RubberDandelionOmics

Gene overview

LXL04_002118

Reference: OH-1004 Chr: Chr01 Coordinates: 42078641-42082387 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2526 bp · LXL04_002118|LXL04_002118|OH1004|cDNA

ATGATGGCGATGTCATGCAAGGATGGTAAGGGTGCAATAATGGATAATGGCAAGTATGTTCGATACACACCTGAGCAGGTTGAAGCTCTTGAAAGGCTATACCATGAGTGCCCAAAACCGAGTTCCATTCGTCGTCAACAACTCATTCGCGAATGCCCTATTCTCTCCAACATTGAACCCAAACAGATCAAAGTTTGGTTCCAAAATCgaagATGCAGAGAGAAACAAAGGAAAGAGGCTTCCCGTCTTCAGTCTGTGAA...

CDS

Download CDS FASTA

2526 bp · LXL04_002118|LXL04_002118|OH1004|CDS

ATGATGGCGATGTCATGCAAGGATGGTAAGGGTGCAATAATGGATAATGGCAAGTATGTTCGATACACACCTGAGCAGGTTGAAGCTCTTGAAAGGCTATACCATGAGTGCCCAAAACCGAGTTCCATTCGTCGTCAACAACTCATTCGCGAATGCCCTATTCTCTCCAACATTGAACCCAAACAGATCAAAGTTTGGTTCCAAAATCGAAGATGCAGAGAGAAACAAAGGAAAGAGGCTTCCCGTCTTCAGTCTGTGAA...

Protein

Download Protein FASTA

841 aa · LXL04_002118|LXL04_002118|OH1004|PROTEIN

MMAMSCKDGKGAIMDNGKYVRYTPEQVEALERLYHECPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQSVNRKLTAMNKLLMEENDRLQKQVSHLVYENGCFRQHTQNTTVASKDTSCDSVVSSGQRHLTPQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSIGIVAISHGCTGVAARACGLVGLEPTRVAEILKDRTSWFRDCRAVDVYDVLPTANGGTIELLYMQLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002118`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002118

Location Chr01:42078641-42082387 (+)

Description Similar to ATHB-15: Homeobox-leucine zipper protein ATHB-15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52150`	Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation.	Mutations in the microRNA complementarity site of the INCURVATA4 gene perturb meristem function and adaxialize lateral organs in arabidopsis.2006 · DOI: 10.1104/pp.106.077149
`At4g32880`	Probable transcription factor involved in the regulation of vascular development.	The arabidopsis ATHB-8 HD-zip protein acts as a differentiation-promoting transcription factor of the vascular meristems.2001 · DOI: 10.1104/pp.126.2.643

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0640800`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2XK30`	Probable transcription factor.	No verified direct reference in this release
`Os12g0612700`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002118 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009855 determination of bilateral symmetry Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010014 meristem initiation Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

KEGG gene cross-reference

ath:AT1G52150

ath:AT4G32880

dosa:Os03g0640800

dosa:Os12g0612700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.605

Rank 1 · LXL04_002118 · OH-1004

Cytoplasm0.327

Rank 2 · LXL04_002118 · OH-1004

Cell membrane0.103

Rank 3 · LXL04_002118 · OH-1004

Endoplasmic reticulum0.058

Rank 4 · LXL04_002118 · OH-1004

Plastid0.040

Rank 5 · LXL04_002118 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain18-76 aa

PF01852.26START162-369 aa

PF08670.18MEKHLA698-840 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002118	`PF00046.36`	Homeodomain	18	76	7.1e-16	58.5
LXL04_002118	`PF01852.26`	START	162	369	1.5e-50	172.2
LXL04_002118	`PF08670.18`	MEKHLA	698	840	6.2e-47	159.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU11`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-15	81.094%	Swiss-Prot	strong database homology
`Q39123`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-8	76.655%	Swiss-Prot	strong database homology
`Q6AST1`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX32	70.131%	Swiss-Prot	strong database homology
`A2XK30`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX32	70.131%	Swiss-Prot	strong database homology
`Q2QM96`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX33	68.149%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card