RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G368140
Reference: TK1151 Chr: Chr03 Coordinates: 90831127-90835834 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2707 bp · TkA03G368140|TK1151|cDNA

CCTACCAGCCCCCACTTACTGCCTCCACAACCATACCCCCCACCCGCTATTGCGTTTTCTGCGTGGCTTTTTCTCTCTCAGCATCACAGTCCCACACACAGACGAAAAGCGAAGAAAACGTTGCGACTTCATTTCCTCCTTTTGTTTTCTTCGACCCCCTACCCCACATCTATAGTAACAGTTCAGACAATTGAGTAGAAGCAGTAGCAGACATCCACCATCAGCGCCATGGCTAATCCATAGCAGACGCAGAAAAAAAA...

CDS

Download CDS FASTA

2211 bp · TkA03G368140|TK1151|CDS

ATGGTCATGTCGTCTTCGAATGATAATCATCCACCGACTTCTACCAAAGACCTTTTTCCATCTACATCGCTCGCTCTCACTCTCGGGATTTTTCGTGATATAAAGGAGGCGGTGGATGATCGAAAAGAGGGTGGTGCTAATACGACGGTGACGGAGATCAGCAGTGAGTATTCTGGACCGGCGAGATCACGATCGGATGAAGAATTCGACGCTGATCCTGACGTCGATGACGGAGACGACGATAACAATAAGAACAAAAG...

Protein

Download Protein FASTA

736 aa · TkA03G368140|TK1151|PROTEIN

MVMSSSNDNHPPTSTKDLFPSTSLALTLGIFRDIKEAVDDRKEGGANTTVTEISSEYSGPARSRSDEEFDADPDVDDGDDDNNKNKSKKRKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKRLGLHPRQVKFWFQNRRTQIKAIQERHENSILKSEMDKLRDENKLLRDTIKKGTCPNCGFGNKDAMNHIDEQQLHIENAKLKTEIEKLRKSIGKYPQGTSPTNSCSTGNEHENRSSLDLCSGVFGLETSRIMEIVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G368140
TK1151 IDTkA03G368140
OH-1004 IDLXL04_008474
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G368140
LocationChr03:90831127-90835834 (-)
DescriptionSimilar to GL2: Homeobox-leucine zipper protein GLABRA 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g79840 Transcription factor involved in the determination of epidermal cell identity (Probable). No verified direct reference in this release
At4g21750 Probable transcription factor involved in cell specification and pattern formation during embryogenesis.
Identification of a cis-regulatory element for L1 layer-specific gene expression, which is targeted by an L1-specific homeodomain protein.2001 · DOI: 10.1046/j.1365-313x.2001.01047.x
Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292
Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647
At4g04890 Probable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'.
Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292
Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211
Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0760800 Probable transcription factor. No verified direct reference in this release
Os02g0674800 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008474 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009845 seed germination Biological Process
GO:0010029 regulation of seed germination Biological Process
GO:0010062 negative regulation of trichoblast fate specification Biological Process
GO:0030154 cell differentiation Biological Process
GO:0048497 maintenance of floral organ identity Biological Process
GO:0048825 cotyledon development Biological Process
GO:0090627 plant epidermal cell differentiation Biological Process
GO:0090628 plant epidermal cell fate specification Biological Process
GO:2000033 regulation of seed dormancy process Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
KEGG gene cross-reference
ath:AT1G79840
ath:AT4G04890
ath:AT4G21750
dosa:Os01g0760800
dosa:Os08g0187500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.899
Rank 1 · TkA03G368140 · TK1151
Cytoplasm0.140
Rank 2 · TkA03G368140 · TK1151
Cell membrane0.047
Rank 3 · TkA03G368140 · TK1151
Endoplasmic reticulum0.024
Rank 4 · TkA03G368140 · TK1151
Plastid0.021
Rank 5 · TkA03G368140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02724CDC458-166 aa
PF28121VPA126784-109 aa
PF12824MRP-L2085-153 aa
PF29997SPC25_N88-124 aa
PF00046Homeodomain90-145 aa
PF14208DUF432090-140 aa
PF05920Homeobox_KN111-142 aa
PF25966Myo5a116-174 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G368140PF02724CDC4581664.16.3
TkA03G368140PF28121VPA1267841093.08.7
TkA03G368140PF12824MRP-L20851530.07613.9
TkA03G368140PF29997SPC25_N881240.6611.0
TkA03G368140PF00046Homeodomain901452.4e-1969.6
TkA03G368140PF14208DUF4320901400.113.3
TkA03G368140PF05920Homeobox_KN1111429e-0626.2
TkA03G368140PF25966Myo5a1161740.001819.0
TkA03G368140PF29997SPC25_N1192140.6611.0
TkA03G368140PF23204KIF21A_2nd1381500.01216.6
TkA03G368140PF28121VPA12671381763.08.7
TkA03G368140PF04977DivIC1431760.5510.8
TkA03G368140PF12808Mto2_bdg1431763.08.9
TkA03G368140PF29363ENTR11471761.49.2
TkA03G368140PF23204KIF21A_2nd1512120.01216.6
TkA03G368140PF07989Cnn_1N1511760.2112.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P46607Arabidopsis thalianasp|P46607|HGL2_ARATH Homeobox-leucine zipper protein GLABRA 258.400%Swiss-ProtHigh
Q8RWU4Arabidopsis thalianasp|Q8RWU4|ATML1_ARATH Homeobox-leucine zipper protein MERISTEM L143.400%Swiss-ProtMedium
Q93V99Arabidopsis thalianasp|Q93V99|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 244.200%Swiss-ProtMedium
Q5JMF3Oryza sativa subsp. japonicasp|Q5JMF3|ROC9_ORYSJ Homeobox-leucine zipper protein ROC947.800%Swiss-ProtMedium
Q6EPF0Oryza sativa subsp. japonicasp|Q6EPF0|ROC5_ORYSJ Homeobox-leucine zipper protein ROC542.100%Swiss-ProtMedium

JBrowse

View in Genome Browser