LXL04_008474 | RubberDandelionOmics

Gene overview

LXL04_008474

Reference: OH-1004 Chr: Chr02 Coordinates: 100608297-100612505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2211 bp · LXL04_008474|LXL04_008474|OH1004|cDNA

ATGGTCATGTCGTCTTCGAATGATAATCATCCACCGACTTCTACCAAAGACCTTTTTCCATCTACATCGCTCGCTCTCACTCTCGGGATTTTTCGTGATATAAAGGAGGCGGTGGATGATCGAAAAGAGGGTGGTGCTAATACGACGGTGACGGAGATCAGCAGTGAGTATTCTGGACCGGCGAGATCACGATCGGATGAAGAATTCGACGCTGATCCTGACGTCGATGACGGAGACGACGATAACAATAAGAACAAAAG...

CDS

Download CDS FASTA

2211 bp · LXL04_008474|LXL04_008474|OH1004|CDS

ATGGTCATGTCGTCTTCGAATGATAATCATCCACCGACTTCTACCAAAGACCTTTTTCCATCTACATCGCTCGCTCTCACTCTCGGGATTTTTCGTGATATAAAGGAGGCGGTGGATGATCGAAAAGAGGGTGGTGCTAATACGACGGTGACGGAGATCAGCAGTGAGTATTCTGGACCGGCGAGATCACGATCGGATGAAGAATTCGACGCTGATCCTGACGTCGATGACGGAGACGACGATAACAATAAGAACAAAAG...

Protein

Download Protein FASTA

736 aa · LXL04_008474|LXL04_008474|OH1004|PROTEIN

MVMSSSNDNHPPTSTKDLFPSTSLALTLGIFRDIKEAVDDRKEGGANTTVTEISSEYSGPARSRSDEEFDADPDVDDGDDDNNKNKSKKRKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKRLGLHPRQVKFWFQNRRTQIKAIQERHENSILKSEMDKLRDENKLLRDTIKKGTCPNCGFGNKDAMNHIDEQQLHIENAKLKTEIEKLRKSIGKYPQGTSPTNSCSTGNEHENRSSLDLCSGVFGLETSRIMEIVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008474`
TK1151 ID	TkA03G368140
OH-1004 ID	LXL04_008474
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008474

Location Chr02:100608297-100612505 (+)

Description Similar to GL2: Homeobox-leucine zipper protein GLABRA 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79840`	Transcription factor involved in the determination of epidermal cell identity (Probable).	No verified direct reference in this release
`At4g21750`	Probable transcription factor involved in cell specification and pattern formation during embryogenesis.	Identification of a cis-regulatory element for L1 layer-specific gene expression, which is targeted by an L1-specific homeodomain protein.2001 · DOI: 10.1046/j.1365-313x.2001.01047.x Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292 Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647
`At4g04890`	Probable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'.	Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292 Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211 Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0760800`	Probable transcription factor.	No verified direct reference in this release
`Os08g0187500`	Probable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis.	Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formation in early rice embryogenesis.2002 · DOI: 10.1046/j.1365-313x.2002.01234.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008474 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009845 seed germination Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010062 negative regulation of trichoblast fate specification Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048497 maintenance of floral organ identity Biological Process

GO:0048825 cotyledon development Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0090628 plant epidermal cell fate specification Biological Process

GO:2000033 regulation of seed dormancy process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G79840

ath:AT4G04890

ath:AT4G21750

dosa:Os01g0760800

dosa:Os08g0187500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · LXL04_008474 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_008474 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_008474 · OH-1004

Endoplasmic reticulum0.025

Rank 4 · LXL04_008474 · OH-1004

Plastid0.021

Rank 5 · LXL04_008474 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain90-145 aa

PF05920.18Homeobox_KN111-142 aa

PF01852.26START261-481 aa

PF25797.2PDF2_C500-733 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008474	`PF00046.36`	Homeodomain	90	145	2.4e-19	69.6
LXL04_008474	`PF05920.18`	Homeobox_KN	111	142	9e-06	26.2
LXL04_008474	`PF01852.26`	START	261	481	3.3e-46	158.0
LXL04_008474	`PF25797.2`	PDF2_C	500	733	3.4e-96	321.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46607`	Arabidopsis thaliana	Homeobox-leucine zipper protein GLABRA 2	58.158%	Swiss-Prot	strong database homology
`Q8RWU4`	Arabidopsis thaliana	Homeobox-leucine zipper protein MERISTEM L1	43.188%	Swiss-Prot	moderate database homology
`Q93V99`	Arabidopsis thaliana	Homeobox-leucine zipper protein PROTODERMAL FACTOR 2	44.913%	Swiss-Prot	moderate database homology
`Q5JMF3`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein ROC9	46.097%	Swiss-Prot	moderate database homology
`Q6ZAR0`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein ROC1	43.571%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card