RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G358200
Reference: TK1151 Chr: Chr03 Coordinates: 88348287-88351335 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2512 bp · TkA03G358200|TK1151|cDNA

AACCACATGTCAATCACCCTATACTTGGATTGTTTTATTTAGGTTGCAAGTACCAAGTCTCACTAATGCGCTATTCTTGGCAAAAGACATGCAAACTTTACTCTTTGACCCGTTGTTCACTCTCATCTCCCAAACTCAAGGAAGAAGTCCGGAAACAAAAAGAAGAAAAAAGAAAATAAAAGAAAAGAGGAAGTTGTTGATCATAAAATCAGACAATTGAATCGTGTCAAGAAGTCATTACAACTTAAATCTATGTACCT...

CDS

Download CDS FASTA

2001 bp · TkA03G358200|TK1151|CDS

ATGGTCCAGTTTGTGCCCACCCCACCATCGCCATCACCATCACCATTGATTACAAGATCACTAACACCACTCAAAATTAAGATCGGCAATCGATTGAATTGTCACCTAAGAAATGCCGTCACCCTTGTATCTCTTGTTTACCTCCTGGTAACGAGGTGTGAATCAGCTTCACCAGAAGATGGAGAGAAGGAAAGAAACGCACTATTGGAATTCAAGAGTTCATTAGAGAATGCAGACAATGCGCTAAGAAACTGGAACAA...

Protein

Download Protein FASTA

666 aa · TkA03G358200|TK1151|PROTEIN

MVQFVPTPPSPSPSPLITRSLTPLKIKIGNRLNCHLRNAVTLVSLVYLLVTRCESASPEDGEKERNALLEFKSSLENADNALRNWNNPPRCPCPQVDSGSGSQTPRMCWTGVICDNGNVWGLQLDNLKLSGEIDVDSLLQLGQLRSLSFSNNKFEGPLPEFSKLEGLKALYICKNNFSGDIDDDAFLGMSSLKEVSMAENEFSGKIPRSLASSPSLTDLRIENNQFTGIIPNFVSTTLVFFNASNNQLQGPIPPSLKDIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G358200
TK1151 IDTkA03G358200
OH-1004 IDLXL04_028486
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)38.300
Protein coverage (%)TK1151 94.745 / OH-1004 95.638
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G358200
LocationChr03:88348287-88351335 (-)
DescriptionSimilar to PRK1: Pollen receptor-like kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g07040 Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.
A distinct mechanism regulating a pollen-specific guanine nucleotide exchange factor for the small GTPase Rop in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705874104
AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
The juxtamembrane and carboxy-terminal domains of Arabidopsis PRK2 are critical for ROP-induced growth in pollen tubes.2013 · DOI: 10.1093/jxb/ert323
At3g20190 Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth. No verified direct reference in this release
At5g35390 Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.
AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
At4g31250 Probable LRR receptor-like serine/threonine-protein kinase At4g31250. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028486 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009846 pollen germination Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0080092 regulation of pollen tube growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016324 apical plasma membrane Cellular Component
GO:0045177 apical part of cell Cellular Component
GO:0090406 pollen tube Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G50610
ath:AT2G07040
ath:AT3G20190
ath:AT4G31250
ath:AT5G35390
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.874
Rank 1 · TkA03G358200 · TK1151
Endoplasmic reticulum0.087
Rank 2 · TkA03G358200 · TK1151
Cytoplasm0.069
Rank 3 · TkA03G358200 · TK1151
Nucleus0.049
Rank 4 · TkA03G358200 · TK1151
Lysosome / Vacuole0.023
Rank 5 · TkA03G358200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05008V-SNARE52-84 aa
PF08263LRRNT_263-115 aa
PF23211LRR_LRWD1117-221 aa
PF13855LRR_8132-175 aa
PF00560LRR_1143-162 aa
PF12799LRR_4143-183 aa
PF13855LRR_8166-226 aa
PF00560LRR_1167-183 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G358200PF05008V-SNARE52840.2212.7
TkA03G358200PF08263LRRNT_2631151.6e-0629.0
TkA03G358200PF23211LRR_LRWD11172210.03214.6
TkA03G358200PF13855LRR_81321754.9e-1142.9
TkA03G358200PF00560LRR_11431622.9e-1244.9
TkA03G358200PF12799LRR_41431838.2e-0936.2
TkA03G358200PF13855LRR_81662264.9e-1142.9
TkA03G358200PF00560LRR_11671832.9e-1244.9
TkA03G358200PF00560LRR_11912112.9e-1244.9
TkA03G358200PF12799LRR_41912288.2e-0936.2
TkA03G358200PF00560LRR_12152342.9e-1244.9
TkA03G358200PF12799LRR_42372568.2e-0936.2
TkA03G358200PF00560LRR_12382572.9e-1244.9
TkA03G358200PF07714PK_Tyr_Ser-Thr3906584.2e-34118.7
TkA03G358200PF00069Pkinase3906562.8e-32112.9
TkA03G358200PF05008V-SNARE6176600.2212.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84JQ4Arabidopsis thalianasp|Q84JQ4|PRK2_ARATH Pollen receptor-like kinase 245.100%Swiss-ProtMedium
Q9LJY0Arabidopsis thalianasp|Q9LJY0|PRK4_ARATH Pollen receptor-like kinase 442.700%Swiss-ProtMedium
C0LGU0Arabidopsis thalianasp|C0LGU0|PRK1_ARATH Pollen receptor-like kinase 142.300%Swiss-ProtMedium
C0LGR9Arabidopsis thalianasp|C0LGR9|Y4312_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g3125044.200%Swiss-ProtMedium

JBrowse

View in Genome Browser