LXL04_028486 | RubberDandelionOmics

Gene overview

LXL04_028486

Reference: OH-1004 Chr: Chr06 Coordinates: 43340288-43342336 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1860 bp · LXL04_028486|LXL04_028486|OH1004|cDNA

ATGAAGGTGGTCGATGCCTATGTCCACCTCTTTCATGTTCTTGTTTGTATTTCGATCGTCCACCTTGTAAATAGCTCGGAAATCGACACCCTTATGGAGTTCAAGAAATCTGTAACCAATGGCAACAAGCTAACCACTTGGAACCCCTCCACCACCCCATGTAATGGCAACAAACCCAATTGGGAAGGTCTTCTTTGCACCAACGACACCGTTTCGGGTATAAGACTCGAGGGAAAAGATCTTGGAGGTATCATTGACAT...

CDS

Download CDS FASTA

1860 bp · LXL04_028486|LXL04_028486|OH1004|CDS

ATGAAGGTGGTCGATGCCTATGTCCACCTCTTTCATGTTCTTGTTTGTATTTCGATCGTCCACCTTGTAAATAGCTCGGAAATCGACACCCTTATGGAGTTCAAGAAATCTGTAACCAATGGCAACAAGCTAACCACTTGGAACCCCTCCACCACCCCATGTAATGGCAACAAACCCAATTGGGAAGGTCTTCTTTGCACCAACGACACCGTTTCGGGTATAAGACTCGAGGGAAAAGATCTTGGAGGTATCATTGACAT...

Protein

Download Protein FASTA

619 aa · LXL04_028486|LXL04_028486|OH1004|PROTEIN

MKVVDAYVHLFHVLVCISIVHLVNSSEIDTLMEFKKSVTNGNKLTTWNPSTTPCNGNKPNWEGLLCTNDTVSGIRLEGKDLGGIIDINILMKLPSLTTISFQNNSFEGEFPEVKKIRGLRSIFLSGNKFSKEVPENAFEGMRRLKKLYLGDNKFKGRIPFSLTTLPRLRDLMLQNNQFEGEIPAFVNDKLTIVNFANNNLRGPIPKRLQSFPASQFAGNSELCGPPLKKCTAEIPTSTIILIASVVVAALAAITAAFLIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028486`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028486

Location Chr06:43340288-43342336 (-)

Description Similar to PRK1: Pollen receptor-like kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35390`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
`At3g20190`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	No verified direct reference in this release
`At2g07040`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	A distinct mechanism regulating a pollen-specific guanine nucleotide exchange factor for the small GTPase Rop in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705874104 AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103 The juxtamembrane and carboxy-terminal domains of Arabidopsis PRK2 are critical for ROP-induced growth in pollen tubes.2013 · DOI: 10.1093/jxb/ert323
`At4g31250`	Probable LRR receptor-like serine/threonine-protein kinase At4g31250.	No verified direct reference in this release
`At1g50610`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	GRIM REAPER peptide binds to receptor kinase PRK5 to trigger cell death in Arabidopsis.2015 · DOI: 10.15252/embj.201488582

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028486 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0045177 apical part of cell Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G50610

ath:AT2G07040

ath:AT3G20190

ath:AT4G31250

ath:AT5G35390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.897

Rank 1 · LXL04_028486 · OH-1004

Endoplasmic reticulum0.074

Rank 2 · LXL04_028486 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_028486 · OH-1004

Nucleus0.044

Rank 4 · LXL04_028486 · OH-1004

Lysosome / Vacuole0.018

Rank 5 · LXL04_028486 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_225-66 aa

PF13855.13LRR_8117-178 aa

PF12799.14LRR_4143-178 aa

PF00069.32Pkinase325-591 aa

PF07714.24PK_Tyr_Ser-Thr325-526 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028486	`PF08263.18`	LRRNT_2	25	66	8.2e-08	33.1
LXL04_028486	`PF13855.13`	LRR_8	117	178	2.2e-09	37.6
LXL04_028486	`PF12799.14`	LRR_4	143	178	3.7e-10	40.4
LXL04_028486	`PF00069.32`	Pkinase	325	591	5.8e-28	98.7
LXL04_028486	`PF07714.24`	PK_Tyr_Ser-Thr	325	526	6.8e-28	98.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGU0`	Arabidopsis thaliana	Pollen receptor-like kinase 1	46.802%	Swiss-Prot	moderate database homology
`Q9LJY0`	Arabidopsis thaliana	Pollen receptor-like kinase 4	43.662%	Swiss-Prot	moderate database homology
`Q84JQ4`	Arabidopsis thaliana	Pollen receptor-like kinase 2	45.469%	Swiss-Prot	moderate database homology
`C0LGR9`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At4g31250	42.654%	Swiss-Prot	moderate database homology
`Q9LPT1`	Arabidopsis thaliana	Pollen receptor-like kinase 5	44.603%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card