TkA03G351940 | RubberDandelionOmics

Gene overview

TkA03G351940

Reference: TK1151 Chr: Chr03 Coordinates: 86684034-86691008 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1600 bp · TkA03G351940|TK1151|cDNA

AACCATAAGAGGAAAATAACAAAAGGCTGACGACTGAAGATGTGGTTGGCGGTGGTGTTAGGAATAGGGCCGCTGCTAGGATGGCTATTGTGGTGGTGGAACGATATCTGGTATGGGCTAGTCACCGGAAGTCTCCAGTCATCCAACAGTGGCACCAAGCTACCTCCCGGCCACATGGGTCTTCCAATCATTGGTGAAATGTTCATGTTTCTATGGTACTTCAAGTTCCTAAAGTGTCCCGACGATTACATAAATTTCAA...

CDS

Download CDS FASTA

1449 bp · TkA03G351940|TK1151|CDS

ATGTGGTTGGCGGTGGTGTTAGGAATAGGGCCGCTGCTAGGATGGCTATTGTGGTGGTGGAACGATATCTGGTATGGGCTAGTCACCGGAAGTCTCCAGTCATCCAACAGTGGCACCAAGCTACCTCCCGGCCACATGGGTCTTCCAATCATTGGTGAAATGTTCATGTTTCTATGGTACTTCAAGTTCCTAAAGTGTCCCGACGATTACATAAATTTCAAGCGTCGCAAGTATGGTGACGGGATAGGCATTTATAAGAC...

Protein

Download Protein FASTA

482 aa · TkA03G351940|TK1151|PROTEIN

MWLAVVLGIGPLLGWLLWWWNDIWYGLVTGSLQSSNSGTKLPPGHMGLPIIGEMFMFLWYFKFLKCPDDYINFKRRKYGDGIGIYKTHLFGKPSVIVFSPAATKYVFRAEEQFVLEWPNVEIVGKSSIVAVHGKTHTRLRSFVSKSINQPEALRRIAHTVQPRMIASLQSWAKRGIINSYKEVKKVTFENIGMYFASFEPGPTLDTLAESFMGMVGGIRSYPLNIPGFAYHRGIQGRKKTMGIFRKELEKRKKDMEEGSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G351940`
TK1151 ID	TkA03G351940
OH-1004 ID	LXL04_008627
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.340 / OH-1004 50.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G351940`
Location	Chr03:86684034-86691008 (+)
Description	Similar to KAO1: Ent-kaurenoic acid oxidase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008627` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009686 gibberellin biosynthetic process Biological Process GO:0010268 brassinosteroid homeostasis Biological Process GO:0016125 sterol metabolic process Biological Process GO:0016132 brassinosteroid biosynthetic process Biological Process GO:0048868 pollen tube development Biological Process GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0005506 iron ion binding Molecular Function GO:0020037 heme binding Molecular Function GO:0051777 ent-kaurenoic acid monooxygenase activity Molecular Function
KEGG gene cross-reference	ag:BAG68929 ath:AT1G05160 ath:AT2G32440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.914

Rank 1 · TkA03G351940 · TK1151

Cytoplasm0.045

Rank 2 · TkA03G351940 · TK1151

Cell membrane0.041

Rank 3 · TkA03G351940 · TK1151

Golgi apparatus0.031

Rank 4 · TkA03G351940 · TK1151

Mitochondrion0.029

Rank 5 · TkA03G351940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45042-458 aa

PF19196DUF5871185-202 aa

PF25322RBD_SIN1257-279 aa

PF16039DUF4791265-320 aa

PF19196DUF5871317-389 aa

PF25322RBD_SIN1318-355 aa

PF19291TREH_N450-475 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G351940	`PF00067`	p450	42	458	3.6e-53	181.7
TkA03G351940	`PF19196`	DUF5871	185	202	0.097	13.2
TkA03G351940	`PF25322`	RBD_SIN1	257	279	0.83	10.4
TkA03G351940	`PF16039`	DUF4791	265	320	0.017	15.4
TkA03G351940	`PF19196`	DUF5871	317	389	0.097	13.2
TkA03G351940	`PF25322`	RBD_SIN1	318	355	0.83	10.4
TkA03G351940	`PF19291`	TREH_N	450	475	0.04	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card