LXL04_008627 | RubberDandelionOmics

Gene overview

LXL04_008627

Reference: OH-1004 Chr: Chr02 Coordinates: 104574237-104580991 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2847 bp · LXL04_008627|LXL04_008627|OH1004|cDNA

ATGTGGTTGGCGGTGGTGTTAGGAATAGGGCCGCTGCTAGGATGGCTATTGTGGTGGTGGAACGATATCTGGTATGGGCTAGTCACCGGAAGTCTCCAGTCATCCAACAGTGGCACCAAGCTACCTCCCGGCCACATGGGTCTTCCAATCATTGGTGAAATGTTCATGTTTCTATGGTACTTCAAGTTCCTAAAGTGTCCCGACGATTACATAAATTTCAAGCGTCGCAAGTATGGTGACGGGATAGGCATTTATAAGAC...

CDS

Download CDS FASTA

2847 bp · LXL04_008627|LXL04_008627|OH1004|CDS

ATGTGGTTGGCGGTGGTGTTAGGAATAGGGCCGCTGCTAGGATGGCTATTGTGGTGGTGGAACGATATCTGGTATGGGCTAGTCACCGGAAGTCTCCAGTCATCCAACAGTGGCACCAAGCTACCTCCCGGCCACATGGGTCTTCCAATCATTGGTGAAATGTTCATGTTTCTATGGTACTTCAAGTTCCTAAAGTGTCCCGACGATTACATAAATTTCAAGCGTCGCAAGTATGGTGACGGGATAGGCATTTATAAGAC...

Protein

Download Protein FASTA

948 aa · LXL04_008627|LXL04_008627|OH1004|PROTEIN

MWLAVVLGIGPLLGWLLWWWNDIWYGLVTGSLQSSNSGTKLPPGHMGLPIIGEMFMFLWYFKFLKCPDDYINFKRRKYGDGIGIYKTHLFGKPSVIVFSPAATKYVFRAEEQFVLEWPNVEIVGKSSIVAVHGKTHTRLRSFVSKSINQPEALRRIAHTVQPRMIASLQSWAKRGIINSYKEVKKVTFENIGMYFASFEPGPTLDTLAESFMGMVGGIRSYPLNIPGFAYHRGIQGRKKTMGIFRKELEKRKKDMEEGSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008627`
TK1151 ID	TkA03G351940
OH-1004 ID	LXL04_008627
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.340 / OH-1004 50.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008627

Location Chr02:104574237-104580991 (-)

Description Similar to KAO1: Ent-kaurenoic acid oxidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05160`	Catalyzes three successive oxidations of ent-kaurenoic acid giving gibberellin 12 (GA12), a key step in gibberellins (GAs) biosynthesis.	No verified direct reference in this release
`At2g32440`	Catalyzes three successive oxidations of ent-kaurenoic acid giving gibberellin 12 (GA12), a key step in gibberellins (GAs) biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0110000`	Involved in gibberellin (GA) biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008627 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0016132 brassinosteroid biosynthetic process Biological Process

GO:0048868 pollen tube development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0020037 heme binding Molecular Function

GO:0051777 ent-kaurenoic acid monooxygenase activity Molecular Function

KEGG gene cross-reference

ag:BAG68929

ath:AT1G05160

ath:AT2G32440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.877

Rank 1 · LXL04_008627 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_008627 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_008627 · OH-1004

Lysosome / Vacuole0.043

Rank 4 · LXL04_008627 · OH-1004

Mitochondrion0.039

Rank 5 · LXL04_008627 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45042-458 aa

PF00067.28p450508-926 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008627	`PF00067.28`	p450	42	458	2.1e-107	360.5
LXL04_008627	`PF00067.28`	p450	508	926	2.1e-107	360.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23051`	Arabidopsis thaliana	Ent-kaurenoic acid oxidase 1	37.255%	Swiss-Prot	weak database homology
`Q9C5Y2`	Arabidopsis thaliana	Ent-kaurenoic acid oxidase 2	35.955%	Swiss-Prot	weak database homology
`Q5VRM7`	Oryza sativa subsp. japonica	Ent-kaurenoic acid oxidase	35.841%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card