TkA03G348300 | RubberDandelionOmics

Gene overview

TkA03G348300

Reference: TK1151 Chr: Chr03 Coordinates: 85703736-85704886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1043 bp · TkA03G348300|TK1151|cDNA

TGGATCGCCACGATTTCAATTTTCGGAGACATAAATAATTTAATTAAAATTCAACAAAACTATCTTCAATTCCCAACTTGTATCTCGCTTATCAGTCACCTTCTTCAACTTCTTCAACCTGACGCTTTCATAACGACATAACGTTTTGCCCTCCCACTCTCCCAGCGTCTCCCCGGACTCCGACGTGGCGACTGACGAGTGACCTTCTCAAACCACCGGTTTCTGTAGTTCGACTTACCGCCGCCTCACCATGTCCATTC...

CDS

Download CDS FASTA

657 bp · TkA03G348300|TK1151|CDS

ATGTTGGCACGAGATTTCCTCAAGAATATGAAGTCGTTGCTGAAAACCAAATGGCGGAATGTCGATACTTTAAGTTATTCTCTGGTACGTCACTACTCTTCAGTTCCGCCAACACCACCATTAACCGACCTTGAAAAGCTGTGCGACGTTGTCACTCATGGGATTGGCAGTCTAGATGACCTAGAAGCAACTCTTAACTCCATCAATGTCTCTTGCTGCTCCTCACTCATCACTCAGGTACTCGATTCTACCAAAAACGA...

Protein

Download Protein FASTA

219 aa · TkA03G348300|TK1151|PROTEIN

MLARDFLKNMKSLLKTKWRNVDTLSYSLVRHYSSVPPTPPLTDLEKLCDVVTHGIGSLDDLEATLNSINVSCCSSLITQVLDSTKNEAPTRRLLRFFLWSEKHSVTRLDDKDYNHAIRVIAEKKDFLSLHMLISNLSNQNRAMETSTFCTVSSTLVQLGRVDEALGIFKNLNKLKCPQDTTTITAIVSALCSKGHVKRAEGVIHHHKHKLSTPNLKLII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G348300`
TK1151 ID	TkA03G348300
OH-1004 ID	LXL04_008662
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 95.890 / OH-1004 42.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G348300

Location Chr03:85703736-85704886 (-)

Description Similar to At5g61370: Pentatricopeptide repeat-containing protein At5g61370, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61370`	Pentatricopeptide repeat-containing protein At5g61370, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008662 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006417 regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005840 ribosome Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0043022 ribosome binding Molecular Function

KEGG gene cross-reference

ath:AT3G49730

ath:AT5G60960

ath:AT5G61370

ath:AT5G65820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.812

Rank 1 · TkA03G348300 · TK1151

Plastid0.085

Rank 2 · TkA03G348300 · TK1151

Nucleus0.062

Rank 3 · TkA03G348300 · TK1151

Cytoplasm0.042

Rank 4 · TkA03G348300 · TK1151

Cell membrane0.011

Rank 5 · TkA03G348300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_23-11 aa

PF01535PPR3-12 aa

PF29070MSC6_N108-197 aa

PF13041PPR_2113-151 aa

PF17177PPR_long113-212 aa

PF23276TPR_24133-205 aa

PF01535PPR147-173 aa

PF12854PPR_1147-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G348300	`PF13041`	PPR_2	3	11	4.1e-05	24.3
TkA03G348300	`PF01535`	PPR	3	12	7.6e-05	23.4
TkA03G348300	`PF29070`	MSC6_N	108	197	0.0035	17.2
TkA03G348300	`PF13041`	PPR_2	113	151	4.1e-05	24.3
TkA03G348300	`PF17177`	PPR_long	113	212	0.17	12.0
TkA03G348300	`PF23276`	TPR_24	133	205	0.023	15.3
TkA03G348300	`PF01535`	PPR	147	173	7.6e-05	23.4
TkA03G348300	`PF12854`	PPR_1	147	169	0.00027	21.3
TkA03G348300	`PF13041`	PPR_2	154	191	4.1e-05	24.3
TkA03G348300	`PF13041`	PPR_2	179	204	4.1e-05	24.3
TkA03G348300	`PF12854`	PPR_1	181	202	0.00027	21.3
TkA03G348300	`PF01535`	PPR	184	203	7.6e-05	23.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLJ6`	Arabidopsis thaliana	sp\|Q9FLJ6\|PP439_ARATH Pentatricopeptide repeat-containing protein At5g61370, mitochondrial	51.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card