Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1473 bp · LXL04_008662|LXL04_008662|OH1004|cDNA
ATGAAGTCGTTGCTGAAAACCAAATGGCGGAATGTCGATACTTTAAGTTATTCTCTGGTACGTCACTACTCTTCAGTTCCGTCAACACCACCATTAACCGACCTTGAAAAGCTGTGCGACGTTGTCACTCATGGGATTGGCAGTCTAGATGACCTAGAAGCAACTCTTAACTCCATCAATGTCTCTTGCTGCTCCTCACTCATCACTCAGGTACTCGATTCTACCAAAAACGAAGCTCCCACAAGACGCCTCCTTAGATT...
1473 bp · LXL04_008662|LXL04_008662|OH1004|CDS
ATGAAGTCGTTGCTGAAAACCAAATGGCGGAATGTCGATACTTTAAGTTATTCTCTGGTACGTCACTACTCTTCAGTTCCGTCAACACCACCATTAACCGACCTTGAAAAGCTGTGCGACGTTGTCACTCATGGGATTGGCAGTCTAGATGACCTAGAAGCAACTCTTAACTCCATCAATGTCTCTTGCTGCTCCTCACTCATCACTCAGGTACTCGATTCTACCAAAAACGAAGCTCCCACAAGACGCCTCCTTAGATT...
Protein
Download Protein FASTA490 aa · LXL04_008662|LXL04_008662|OH1004|PROTEIN
MKSLLKTKWRNVDTLSYSLVRHYSSVPSTPPLTDLEKLCDVVTHGIGSLDDLEATLNSINVSCCSSLITQVLDSTKNEAPTRRLLRFFLWSEKHSVTRLDDKDYNHAIRVIAEKKDFLSLHMLISNLSNQNRAMETSTFCTVSSTLVQLGRVDEALGIFKNLNKLKCPQDTTTITAIVSALCSKGHVKRAEGVIHHHKHKLSTPNLKLIIYKNLLHGYSLQKNIKESRKILKDMKGAKITPDIFIYNTFLNCLCEKNLKS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008662 |
|---|---|
| TK1151 ID | TkA03G348300 |
| OH-1004 ID | LXL04_008662 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 95.890 / OH-1004 42.857Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008662 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:105467051-105468523 (+) | ||||||||||||||||||
| Description | Similar to At5g61370: Pentatricopeptide repeat-containing protein At5g61370, mitochondrial | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006417 regulation of translation Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005840 ribosome Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0043022 ribosome binding Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT3G49730 ath:AT5G60960 ath:AT5G61370 ath:AT5G65820 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13812.13PPR_3208-252 aaPF13041.13PPR_2209-254 aaPF13041.13PPR_2264-296 aaPF13812.13PPR_3268-296 aaPF12854.14PPR_1281-312 aaPF13041.13PPR_2283-322 aaPF01535.27PPR286-312 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008662 | PF13812.13 | PPR_3 | 208 | 252 | 1.5e-14 | 54.5 |
| LXL04_008662 | PF13041.13 | PPR_2 | 209 | 254 | 5.4e-25 | 88.0 |
| LXL04_008662 | PF13041.13 | PPR_2 | 264 | 296 | 5.4e-25 | 88.0 |
| LXL04_008662 | PF13812.13 | PPR_3 | 268 | 296 | 1.5e-14 | 54.5 |
| LXL04_008662 | PF12854.14 | PPR_1 | 281 | 312 | 9.6e-17 | 61.2 |
| LXL04_008662 | PF13041.13 | PPR_2 | 283 | 322 | 5.4e-25 | 88.0 |
| LXL04_008662 | PF01535.27 | PPR | 286 | 312 | 1.3e-21 | 76.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9FLJ6 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At5g61370, mitochondrial | 57.635% | Swiss-Prot | strong database homology |
Q9FME4 | Arabidopsis thaliana | Small ribosomal subunit protein mL104 (rPPR9) | 26.859% | Swiss-Prot | weak database homology |
P0C8A0 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At3g49730 | 24.146% | Swiss-Prot | weak database homology |
Q9FH87 | Arabidopsis thaliana | Putative pentatricopeptide repeat-containing protein At5g65820 | 23.294% | Swiss-Prot | weak database homology |
Q9LUJ4 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At3g22670, mitochondrial | 23.596% | Swiss-Prot | weak database homology |