TkA03G348240 | RubberDandelionOmics

Gene overview

TkA03G348240

Reference: TK1151 Chr: Chr03 Coordinates: 85691919-85693649 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1636 bp · TkA03G348240|TK1151|cDNA

TAAAACCTCCAATTTAGTACTTTTTAATTTTATCAACTTCTCTTCATTGTCTTAATGCCATTTTACATAAACAAATTAACACGTACTGACACACACTCATATACACACACAAACAGTCGGTGCTCTCTTGCATCTACCATCTTACTCTCACCCACGTTCTAAATTATAATAATCTTTGAAATTCTTGATTGTGTCCATAATGGAAGGAAATTTCAAATCTTCCATGACTGAATCACTTGTTTTTTGATTCATAAACTATT...

CDS

Download CDS FASTA

786 bp · TkA03G348240|TK1151|CDS

ATGGCGCATTTGGATAAAGAGCTTGCTGGGTATTGGGCAAAACTGCCATTAATTCGCAGGTTGATGCTCTCTCATCCAGAAGTCGAGTGGATTTGGTGGATGGACAGTGACGCATTGTTCACGGATATGGTTTTCGAAATTCCATTATCCAAATACAAAGATCACAACATGGTCATCCATGGCTACCCAGATTTGTTATTCAATCAAAAATCATGGATCGCTCTCAACACCGGTAGCTTTTTGTTTAGAAATTGTCAATG...

Protein

Download Protein FASTA

261 aa · TkA03G348240|TK1151|PROTEIN

MAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFEIPLSKYKDHNMVIHGYPDLLFNQKSWIALNTGSFLFRNCQWSLDLLDEWAPMGPKGPVREEAGKILTANLKGRPAFEADDQSALIYLLITKTEWMKKVFVENSYFLHGYWAGLVDRYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVQRCLSSMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPLENVDQFDIRHSAQGTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G348240`
TK1151 ID	TkA03G348240
OH-1004 ID	LXL04_008663
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 57.616 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G348240

Location Chr03:85691919-85693649 (-)

Description Similar to XXT3: Probable xyloglucan 6-xylosyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07720`	Probable xyloglucan xylosyltransferase involved in the biosynthesis of xyloglucan.	No verified direct reference in this release
`At1g74380`	Probable xyloglucan xylosyltransferase involved in the biosynthesis of xyloglucan in roots.	Arabidopsis XXT5 gene encodes a putative alpha-1,6-xylosyltransferase that is involved in xyloglucan biosynthesis.2008 · DOI: 10.1111/j.1365-313x.2008.03580.x Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At1g18690`	Xylosyltransferase specific to UDP-D-xylose that accepts cellohexaose as substrate to produce xyloglucan.	Arabidopsis GT34 family contains five xyloglucan α-1,6-xylosyltransferases.2012 · DOI: 10.1111/j.1469-8137.2012.04196.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AIZ4`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release
`Os02g0529600`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009969 xyloglucan biosynthetic process Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0048767 root hair elongation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016758 hexosyltransferase activity Molecular Function

GO:0033843 xyloglucan 6-xylosyltransferase activity Molecular Function

GO:0035252 UDP-xylosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18690

ath:AT1G74380

ath:AT5G07720

dosa:Os02g0529600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.790

Rank 1 · TkA03G348240 · TK1151

Endoplasmic reticulum0.136

Rank 2 · TkA03G348240 · TK1151

Cytoplasm0.085

Rank 3 · TkA03G348240 · TK1151

Cell membrane0.054

Rank 4 · TkA03G348240 · TK1151

Extracellular0.051

Rank 5 · TkA03G348240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05637Glyco_transf_343-193 aa

PF11676DUF32728-25 aa

PF03314DUF27364-101 aa

PF11676DUF327265-88 aa

PF11676DUF3272136-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G348240	`PF05637`	Glyco_transf_34	3	193	1.6e-46	159.7
TkA03G348240	`PF11676`	DUF3272	8	25	0.39	11.5
TkA03G348240	`PF03314`	DUF273	64	101	0.067	13.5
TkA03G348240	`PF11676`	DUF3272	65	88	0.39	11.5
TkA03G348240	`PF11676`	DUF3272	136	160	0.39	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF80`	Arabidopsis thaliana	sp\|Q9LF80\|XXT3_ARATH Probable xyloglucan 6-xylosyltransferase 3	87.100%	Swiss-Prot	High
`Q9CA75`	Arabidopsis thaliana	sp\|Q9CA75\|XXT5_ARATH Probable xyloglucan 6-xylosyltransferase 5	85.500%	Swiss-Prot	High
`Q9M9U0`	Arabidopsis thaliana	sp\|Q9M9U0\|XXT4_ARATH Xyloglucan 6-xylosyltransferase 4	82.700%	Swiss-Prot	High
`B8AIZ4`	Oryza sativa subsp. indica	sp\|B8AIZ4\|GT2_ORYSI Probable glycosyltransferase 2	79.300%	Swiss-Prot	High
`Q6H765`	Oryza sativa subsp. japonica	sp\|Q6H765\|GT2_ORYSJ Probable glycosyltransferase 2	79.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card