TkA03G347420 | RubberDandelionOmics

Gene overview

TkA03G347420

Reference: TK1151 Chr: Chr03 Coordinates: 85467963-85474599 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5061 bp · TkA03G347420|TK1151|cDNA

CCTGTTGCCACGAAAGATGGCAAAAATCACATTTTTGTAAATCCCTTTGACAACAATATACTCCAGCTTTTTTTATATTTGTTTCTTCGAACTTGAAACCCTTGAATCTCTCCATATCTCCTGCATAATCTTTCTTTGTTTGTTCTTTTAGATTCCACGTGTATGTGATAATCACAGATTTGCATCTCACTGATTCACACAATTAGTCGAAAGGTTCGGGTCTACGATTCTTCTTTCCTTTTTCCACACTCCCCCGTTTC...

CDS

Download CDS FASTA

4125 bp · TkA03G347420|TK1151|CDS

ATGGCGCTGTTCAAACGCTTCTTTTATCGTAAGCCGCCGGATCGCCTCCTTGAGATCTCCGAGAGGGTTTACGTTTTTGATTGCTGCTTCTCAAGTGAAGTACTCGAAGAAGATGAATACAAGATGTACATGGGCGGCATTGTTGCAGAACTCCAAGACTACTACCCCGACTCATCTTTCATGGTGTTCAACTTCAGAGAAGGCGACAAAAGGACCCAAATTTCAGACATATTATCTCAATACGACATGACAGTAATGGA...

Protein

Download Protein FASTA

1374 aa · TkA03G347420|TK1151|PROTEIN

MALFKRFFYRKPPDRLLEISERVYVFDCCFSSEVLEEDEYKMYMGGIVAELQDYYPDSSFMVFNFREGDKRTQISDILSQYDMTVMEYPRQHEGCPMLPLEMIHHFLRSSESWLSLAGQQNVLLMHCERGGWPVLAFMLAALLLFRKQYNGEQKTLDMVYKQAPKELLHLLTPLNPQPSQLRYLQYISRRNLGSDWPPSDTPLALDCIILRVLPVFGEKGCRPVVRVYGQDSSLTTANRSSKLLFSSSKTKKQARYYQPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G347420`
TK1151 ID	TkA03G347420
OH-1004 ID	LXL04_008670
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G347420

Location Chr03:85467963-85474599 (+)

Description Similar to FH20: Formin-like protein 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9FLQ7`	Formin-like protein 20.	No verified direct reference in this release
`At2g25050`	Formin-like protein 18.	No verified direct reference in this release
`At5g58160`	Formin-like protein 13.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0280200`	Formin-like protein 6.	No verified direct reference in this release
`Os07g0596300`	Formin-like protein 5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008670 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G07740

dosa:Os07g0596300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · TkA03G347420 · TK1151

Cell membrane0.379

Rank 2 · TkA03G347420 · TK1151

Nucleus0.224

Rank 3 · TkA03G347420 · TK1151

Golgi apparatus0.055

Rank 4 · TkA03G347420 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA03G347420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22927INT1_R373-122 aa

PF10409PTEN_C2199-336 aa

PF02181FH2971-1339 aa

PF10409PTEN_C21130-1146 aa

PF22927INT1_R31197-1322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G347420	`PF22927`	INT1_R3	73	122	0.019	15.3
TkA03G347420	`PF10409`	PTEN_C2	199	336	1.1e-33	116.5
TkA03G347420	`PF02181`	FH2	971	1339	1.8e-114	383.5
TkA03G347420	`PF10409`	PTEN_C2	1130	1146	1.1e-33	116.5
TkA03G347420	`PF22927`	INT1_R3	1197	1322	0.019	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLQ7`	Arabidopsis thaliana	sp\|Q9FLQ7\|FH20_ARATH Formin-like protein 20	54.200%	Swiss-Prot	High
`Q9SK28`	Arabidopsis thaliana	sp\|Q9SK28\|FH18_ARATH Formin-like protein 18	46.100%	Swiss-Prot	Medium
`Q9LVN1`	Arabidopsis thaliana	sp\|Q9LVN1\|FH13_ARATH Formin-like protein 13	45.300%	Swiss-Prot	Medium
`Q6ZCX3`	Oryza sativa subsp. japonica	sp\|Q6ZCX3\|FH6_ORYSJ Formin-like protein 6	48.000%	Swiss-Prot	Medium
`Q84ZL0`	Oryza sativa subsp. japonica	sp\|Q84ZL0\|FH5_ORYSJ Formin-like protein 5	50.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card