TkA03G343420 | RubberDandelionOmics

Gene overview

TkA03G343420

Reference: TK1151 Chr: Chr03 Coordinates: 84470833-84471978 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

629 bp · TkA03G343420|TK1151|cDNA

GAAACATGAATATAGTAACGAATGAGGGCAATATTGAAGCTGGATAGATTTGGGCGGCGGGAGCTTCCAGTATATAACACCGACAACGGTTGTTCTCCACTATCTTCGCTTCGATCCAGATCTGATCTGAAACGCAAACCGAGATCATGGGCCGTGGAGTCAGCAGCGGTGGAGGACAGAGTTCACTCGACTACCTTTTCGGAAATGGAGAGCCAAAGCCCACCACAGGCAAGCCAGAGGCGGTTGCTCCAGCTCCGGTG...

CDS

Download CDS FASTA

360 bp · TkA03G343420|TK1151|CDS

ATGGGCCGTGGAGTCAGCAGCGGTGGAGGACAGAGTTCACTCGACTACCTTTTCGGAAATGGAGAGCCAAAGCCCACCACAGGCAAGCCAGAGGCGGTTGCTCCAGCTCCGGTGAACCACATACACGTAGCCGCCACCAATGAGCCACCTCCCAAGCCTACCGCCACCGTGCCCCAGCCATCAGATATCACAAACCAGATTCCGGCCGGGATTCAGCAGGGTAGCCAGGCAAACAACTATTTCCGAGCTGAAGGGCAGAA...

Protein

Download Protein FASTA

119 aa · TkA03G343420|TK1151|PROTEIN

MGRGVSSGGGQSSLDYLFGNGEPKPTTGKPEAVAPAPVNHIHVAATNEPPPKPTATVPQPSDITNQIPAGIQQGSQANNYFRAEGQNTGNFLTDRPSTKVHAAPGGGSSLGYLFGDGSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G343420`
TK1151 ID	TkA03G343420
OH-1004 ID	LXL04_008712
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G343420

Location Chr03:84470833-84471978 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26355`	Acts redundantly with SPR1 in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release
`At1g69230`	Acts redundantly with SPR1 in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0629400`	Acts in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release
`Os03g0417800`	Acts in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release
`Os12g0502000`	Acts in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005876 spindle microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0009574 preprophase band Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

KEGG gene cross-reference

ath:AT1G26355

ath:AT1G69230

ath:AT2G03680

ath:AT5G15600

dosa:Os03g0417800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.802

Rank 1 · TkA03G343420 · TK1151

Nucleus0.263

Rank 2 · TkA03G343420 · TK1151

Cell membrane0.078

Rank 3 · TkA03G343420 · TK1151

Mitochondrion0.057

Rank 4 · TkA03G343420 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA03G343420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09598Stm1_N43-89 aa

PF09598Stm1_N96-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G343420	`PF09598`	Stm1_N	43	89	4.0	9.0
TkA03G343420	`PF09598`	Stm1_N	96	103	4.0	9.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H4F1`	Arabidopsis thaliana	sp\|B3H4F1\|SP1L1_ARATH Protein SPIRAL1-like 1	63.600%	Swiss-Prot	High
`Q9LE54`	Arabidopsis thaliana	sp\|Q9LE54\|SP1L2_ARATH Protein SPIRAL1-like 2	58.100%	Swiss-Prot	High
`Q2R0W8`	Oryza sativa subsp. japonica	sp\|Q2R0W8\|SP1L2_ORYSJ Protein SPIRAL1-like 2	60.800%	Swiss-Prot	High
`Q7Y1L9`	Oryza sativa subsp. japonica	sp\|Q7Y1L9\|SP1L1_ORYSJ Protein SPIRAL1-like 1	57.000%	Swiss-Prot	High
`Q2QQ99`	Oryza sativa subsp. japonica	sp\|Q2QQ99\|SP1L3_ORYSJ Protein SPIRAL1-like 3	57.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card