LXL04_008712 | RubberDandelionOmics

Gene overview

LXL04_008712

Reference: OH-1004 Chr: Chr02 Coordinates: 106618912-106619377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

394 bp · LXL04_008712|LXL04_008712|OH1004|cDNA

ATGGGCCGTGGAGTCAGCAGCGGTGGAGGACAGAGTTCACTCGACTACCTTTTCGGAAATGGAGAGCCAAAGCCCACCACAGGCAAGCCAGAGGCGGTTGCTCCAGCTCCGGTGAACCACATACACGTAGCCGCCACCAATGAGCCACCTCCCAAGCCTACCGCCACCGTGCCCCAGCCATCAGATATCACAAACCAGATTCCGGCCGGGATTCAGCAGGGTAGCCAGGCAAACAACTATTTCCGAGCTGAAGGGCAGAA...

CDS

Download CDS FASTA

360 bp · LXL04_008712|LXL04_008712|OH1004|CDS

ATGGGCCGTGGAGTCAGCAGCGGTGGAGGACAGAGTTCACTCGACTACCTTTTCGGAAATGGAGAGCCAAAGCCCACCACAGGCAAGCCAGAGGCGGTTGCTCCAGCTCCGGTGAACCACATACACGTAGCCGCCACCAATGAGCCACCTCCCAAGCCTACCGCCACCGTGCCCCAGCCATCAGATATCACAAACCAGATTCCGGCCGGGATTCAGCAGGGTAGCCAGGCAAACAACTATTTCCGAGCTGAAGGGCAGAA...

Protein

Download Protein FASTA

119 aa · LXL04_008712|LXL04_008712|OH1004|PROTEIN

MGRGVSSGGGQSSLDYLFGNGEPKPTTGKPEAVAPAPVNHIHVAATNEPPPKPTATVPQPSDITNQIPAGIQQGSQANNYFRAEGQNTGNFLTDRPSTKVHAAPGGGSSLGYLFGDGSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008712`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008712

Location Chr02:106618912-106619377 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26355`	Acts redundantly with SPR1 in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release
`At1g69230`	Acts redundantly with SPR1 in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release
`At2g03680`	Required for directional control of cell elongation.	The SPIRAL genes are required for directional control of cell elongation in Aarabidopsis thaliana.2000 · DOI: 10.1242/dev.127.20.4443 SPIRAL1 encodes a plant-specific microtubule-localized protein required for directional control of rapidly expanding Arabidopsis cells.2004 · DOI: 10.1105/tpc.017830 The Arabidopsis sku6/spiral1 gene encodes a plus end-localized microtubule-interacting protein involved in directional cell expansion.2004 · DOI: 10.1105/tpc.020644 Role of the SPIRAL1 gene family in anisotropic growth of Arabidopsis thaliana.2006 · DOI: 10.1093/pcp/pcj020 Salt stress-induced disassembly of Arabidopsis cortical microtubule arrays involves 26S proteasome-dependent degradation of SPIRAL1.2011 · DOI: 10.1105/tpc.111.089920
`At5g15600`	Acts redundantly with SPR1 in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0417800`	Acts in maintaining the cortical microtubules organization essential for anisotropic cell growth.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008712 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005876 spindle microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0009574 preprophase band Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

KEGG gene cross-reference

ath:AT1G26355

ath:AT1G69230

ath:AT2G03680

ath:AT5G15600

dosa:Os03g0417800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.802

Rank 1 · LXL04_008712 · OH-1004

Nucleus0.263

Rank 2 · LXL04_008712 · OH-1004

Cell membrane0.078

Rank 3 · LXL04_008712 · OH-1004

Mitochondrion0.057

Rank 4 · LXL04_008712 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_008712 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H4F1`	Arabidopsis thaliana	Protein SPIRAL1-like 1	63.559%	Swiss-Prot	strong database homology
`Q9LE54`	Arabidopsis thaliana	Protein SPIRAL1-like 2	58.475%	Swiss-Prot	strong database homology
`Q9SJW3`	Arabidopsis thaliana	Protein SPIRAL1	53.600%	Swiss-Prot	strong database homology
`Q9LF22`	Arabidopsis thaliana	Protein SPIRAL1-like 4	51.261%	Swiss-Prot	strong database homology
`Q7Y1L9`	Oryza sativa subsp. japonica	Protein SPIRAL1-like 1	79.310%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card