TkA03G342410 | RubberDandelionOmics

Gene overview

TkA03G342410

Reference: TK1151 Chr: Chr03 Coordinates: 84271928-84273939 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1297 bp · TkA03G342410|TK1151|cDNA

TTCCTCCAAGTCCAAAAACTTTCACCGTCTTTCTCCCCTTATTTATACCGTCCGCTATTGCCTGCTTTCACTCACACAAAACCTTACTCGATCTGTTCTCTTTCAACAACAATGGCTTCCCCTGTAACTCCAACGCCAATTTTGAAAGATGAACTTGATATCGTCATACCAACGATTCGAAACCTTGATTTCCTGGAGATGTGGAGGCCATTCTTCCAACCTTACCATCTTATCATCGTACAAGATGGCGATCCTTCCAA...

CDS

Download CDS FASTA

1176 bp · TkA03G342410|TK1151|CDS

TTCCTCCAAGTCCAAAAACTTTCACCGTCTTTCTCCCCTTATTTATACCGTCCGCTATTGCCTGCTTTCACTCACACAAAACCTTACTCGATCTGTTCTCTTTCAACAACAATGGCTTCCCCTGTAACTCCAACGCCAATTTTGAAAGATGAACTTGATATCGTCATACCAACGATTCGAAACCTTGATTTCCTGGAGATGTGGAGGCCATTCTTCCAACCTTACCATCTTATCATCGTACAAGATGGCGATCCTTCCAA...

Protein

Download Protein FASTA

391 aa · TkA03G342410|TK1151|PROTEIN

FLQVQKLSPSFSPYLYRPLLPAFTHTKPYSICSLSTTMASPVTPTPILKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPSKVIKVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPSGNDINALEQHIKNLLSPSTPFFFNTLYDPYREGTDFVRGYPFSLREGVPTAVSHGLWLNIPDYDAPTQLVKPRERNSRFVDAVLTIPKGTLFPMCGMNLAFDRELIGPAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G342410`
TK1151 ID	TkA03G342410
OH-1004 ID	LXL04_008717
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.600
Protein coverage (%)	TK1151 94.118 / OH-1004 98.537 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G342410

Location Chr03:84271928-84273939 (-)

Description Similar to UPTG: Probable UDP-arabinopyranose mutase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0599800`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008717 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0033356 UDP-L-arabinose metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016866 intramolecular transferase activity Molecular Function

GO:0052691 UDP-arabinopyranose mutase activity Molecular Function

KEGG gene cross-reference

dosa:Os03g0599800

dosa:Os07g0604800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.416

Rank 1 · TkA03G342410 · TK1151

Cytoplasm0.299

Rank 2 · TkA03G342410 · TK1151

Endoplasmic reticulum0.238

Rank 3 · TkA03G342410 · TK1151

Nucleus0.147

Rank 4 · TkA03G342410 · TK1151

Cell membrane0.085

Rank 5 · TkA03G342410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03214RGP48-382 aa

PF10111Glyco_tranf_2_275-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G342410	`PF03214`	RGP	48	382	1.2e-178	594.2
TkA03G342410	`PF10111`	Glyco_tranf_2_2	75	149	0.12	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H8T0`	Oryza sativa subsp. japonica	sp\|Q8H8T0\|RGP1_ORYSJ UDP-arabinopyranose mutase 1	87.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card