TkA03G336490 | RubberDandelionOmics

Gene overview

TkA03G336490

Reference: TK1151 Chr: Chr03 Coordinates: 82787517-82790300 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1961 bp · TkA03G336490|TK1151|cDNA

ATGGGCCAGGCCCCAACTCGGCAGTTCGGTCAGCCTCCGGTTGACTGAAACACAGCTGCAGACTCTATGCAAATTACTTCTGGTATTTCACGTCGAGGCTTCCACCAACCACCACCAAACACCAAAACGTCTCTGCTTTCGCCGCCACCAACGGCGGAGTTTCCTATAACAACTTCCATTTATATACACATCATTTTTTAGTTCCTTTCTTCCATTCCACCTCTCGCTAGATTGATTCGCAAATTACAATGGCCTTAGCA...

CDS

Download CDS FASTA

1473 bp · TkA03G336490|TK1151|CDS

ATGGCCTTAGCAACTCCCACCACCTCGCTCTCAAAACCCTTCTTCTCCTCTAAACTTTCATCAGCGTCAACAATAATTCCTGTTGTTTCCCTACCAACCACCTCCCGTAAATCTTCGAGGCCGTTGGTCGTTCGGAGCTCCATTGCGGTTGCTCAGTCGCCGTCTACCGCCTCGACGAAATCCTCCACCGTGAAATCGGTGAAGGCGAGGCAGATCATCGACAGCAGAGGAAATCCGACAGTGGAGGTTGATCTTGTAAC...

Protein

Download Protein FASTA

490 aa · TkA03G336490|TK1151|PROTEIN

MALATPTTSLSKPFFSSKLSSASTIIPVVSLPTTSRKSSRPLVVRSSIAVAQSPSTASTKSSTVKSVKARQIIDSRGNPTVEVDLVTDDLYRSAVPSGASTGIYEALELRDGDKSVYGGKGVLNAVKNINEILGPKIIGVDVRNQADFDAIMLEIDGTPNKSKLGANAILGVSLSVCRAGAGAKGIPLYKHIQEISGTKELVMPVPAFNVINGGSHAGNNLAMQEFMILPVGASSFAEALQMGSEVYHTLKGIIQAKYGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G336490`
TK1151 ID	TkA03G336490
OH-1004 ID	LXL04_008763
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G336490

Location Chr03:82787517-82790300 (+)

Description Similar to ENO1: Enolase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74030`	Enolase 1, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0007618 mating Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0031012 extracellular matrix Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

ath:AT1G74030

ddi:DDB_G0283137

rcu:8288376

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · TkA03G336490 · TK1151

Mitochondrion0.047

Rank 2 · TkA03G336490 · TK1151

Cytoplasm0.044

Rank 3 · TkA03G336490 · TK1151

Peroxisome0.035

Rank 4 · TkA03G336490 · TK1151

Nucleus0.016

Rank 5 · TkA03G336490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952Enolase_N47-60 aa

PF03952Enolase_N64-192 aa

PF00113Enolase_C201-488 aa

PF13378MR_MLE_C343-451 aa

PF07476MAAL_C368-451 aa

PF26847Phage_T5_AP_Endonuclease369-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G336490	`PF03952`	Enolase_N	47	60	2.1e-55	187.2
TkA03G336490	`PF03952`	Enolase_N	64	192	2.1e-55	187.2
TkA03G336490	`PF00113`	Enolase_C	201	488	6e-146	486.1
TkA03G336490	`PF13378`	MR_MLE_C	343	451	7.8e-07	29.7
TkA03G336490	`PF07476`	MAAL_C	368	451	0.00061	19.8
TkA03G336490	`PF26847`	Phage_T5_AP_Endonuclease	369	419	0.051	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C4`	Arabidopsis thaliana	sp\|Q9C9C4\|ENO1_ARATH Enolase 1, chloroplastic	91.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card