LXL04_008763 | RubberDandelionOmics

Gene overview

LXL04_008763

Reference: OH-1004 Chr: Chr02 Coordinates: 108326158-108328446 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · LXL04_008763|LXL04_008763|OH1004|cDNA

ATGGCCTTAGCAACTCCCACCACCTCGCTCTCAAAACCCTTCTTCTCCTCTAAACTTTCATCAGCGTCAACAATAATTCCTGTTGTTTCCCTACCAACCACCTCCCGTAAATCTTCGAGGCCGTTGGTCGTTCGGAGCTCCATTGCGTTTGCTCAGTCGCCGTCTACCGCCTCGACGAAATCGTCCACCGTGAAATCGGTGAAGGCGAGGCAGATCATCGACAGCAGAGGAAATCCGACAGTGGAGGTTGATCTCGTAAC...

CDS

Download CDS FASTA

1473 bp · LXL04_008763|LXL04_008763|OH1004|CDS

ATGGCCTTAGCAACTCCCACCACCTCGCTCTCAAAACCCTTCTTCTCCTCTAAACTTTCATCAGCGTCAACAATAATTCCTGTTGTTTCCCTACCAACCACCTCCCGTAAATCTTCGAGGCCGTTGGTCGTTCGGAGCTCCATTGCGTTTGCTCAGTCGCCGTCTACCGCCTCGACGAAATCGTCCACCGTGAAATCGGTGAAGGCGAGGCAGATCATCGACAGCAGAGGAAATCCGACAGTGGAGGTTGATCTCGTAAC...

Protein

Download Protein FASTA

490 aa · LXL04_008763|LXL04_008763|OH1004|PROTEIN

MALATPTTSLSKPFFSSKLSSASTIIPVVSLPTTSRKSSRPLVVRSSIAFAQSPSTASTKSSTVKSVKARQIIDSRGNPTVEVDLVTDDLYRSAVPSGASTGIYEALELRDGDKSVYGGKGVLNAVKNINEILGPKIIGVDVRNQADFDAIMLEIDGTPNKSKLGANAILGVSLSVCRAGAGAKGIPLYKHIQEISGTKELVMPVPAFNVINGGSHAGNNLAMQEFMILPVGASSFAEALQMGSEVYHTLKGIIQAKYGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008763`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008763

Location Chr02:108326158-108328446 (-)

Description Similar to ENO1: Enolase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74030`	Enolase 1, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008763 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0007618 mating Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0031012 extracellular matrix Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

ath:AT1G74030

ddi:DDB_G0283137

rcu:8288376

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · LXL04_008763 · OH-1004

Mitochondrion0.048

Rank 2 · LXL04_008763 · OH-1004

Cytoplasm0.046

Rank 3 · LXL04_008763 · OH-1004

Peroxisome0.037

Rank 4 · LXL04_008763 · OH-1004

Nucleus0.017

Rank 5 · LXL04_008763 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952.22Enolase_N64-192 aa

PF00113.29Enolase_C201-488 aa

PF13378.13MR_MLE_C343-451 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008763	`PF03952.22`	Enolase_N	64	192	2.4e-55	187.0
LXL04_008763	`PF00113.29`	Enolase_C	201	488	6e-146	486.1
LXL04_008763	`PF13378.13`	MR_MLE_C	343	451	7.8e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C4`	Arabidopsis thaliana	Enolase 1, chloroplastic	82.245%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card