TkA03G324190 | RubberDandelionOmics

Gene overview

TkA03G324190

Reference: TK1151 Chr: Chr03 Coordinates: 79680104-79682536 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2373 bp · TkA03G324190|TK1151|cDNA

ATGACGACGAGAGGGAGCAGATCGGAGAAGGTGAGAAGAATTTTCCAGCAGTTTGATTATAACAGAGATGGTGGGCTCAACAGAGAAGAGATGTCTTCCCTTGTCGTCGCTGTAAACCCTAGGGTGAAATTCAGTGATGAACAAATTAGCGCTATCCTCGACGAAGTTTTCCGAACGTACGCCGACTTCATTGACGTCGACCGTGATTTTGAGGCACTTGGGCTTGAATTAAAAGCGGATGACGATAATGAAGCTACTTC...

CDS

Download CDS FASTA

2373 bp · TkA03G324190|TK1151|CDS

ATGACGACGAGAGGGAGCAGATCGGAGAAGGTGAGAAGAATTTTCCAGCAGTTTGATTATAACAGAGATGGTGGGCTCAACAGAGAAGAGATGTCTTCCCTTGTCGTCGCTGTAAACCCTAGGGTGAAATTCAGTGATGAACAAATTAGCGCTATCCTCGACGAAGTTTTCCGAACGTACGCCGACTTCATTGACGTCGACCGTGATTTTGAGGCACTTGGGCTTGAATTAAAAGCGGATGACGATAATGAAGCTACTTC...

Protein

Download Protein FASTA

790 aa · TkA03G324190|TK1151|PROTEIN

MTTRGSRSEKVRRIFQQFDYNRDGGLNREEMSSLVVAVNPRVKFSDEQISAILDEVFRTYADFIDVDRDFEALGLELKADDDNEATSSLALEEASTSSVMERASSAGPRTHRTAAWAASPNHGIIFDDTWKLVDDLEILIKRLKSKQTKDGKTKGENFDAYSDPGWSRELGPSSEIDKRIIWEESGHDYGVFVKELGALRSRADGSRSREEAFDGHMALGRVLYDQQLFNESLLCFKRACELQPTDVRPHFRAGNCYYVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G324190`
TK1151 ID	TkA03G324190
OH-1004 ID	LXL04_030522
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.200
Protein coverage (%)	TK1151 98.481 / OH-1004 98.301 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G324190

Location Chr03:79680104-79682536 (-)

Description Similar to At1g05150: Uncharacterized TPR repeat-containing protein At1g05150

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32450`	Uncharacterized TPR repeat-containing protein At2g32450.	No verified direct reference in this release
`At1g05150`	Uncharacterized TPR repeat-containing protein At1g05150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030522 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000423 mitophagy Biological Process

GO:0000432 positive regulation of transcription from RNA polymerase II promoter by glucose Biological Process

GO:0001933 negative regulation of protein phosphorylation Biological Process

GO:0001934 positive regulation of protein phosphorylation Biological Process

GO:0006041 glucosamine metabolic process Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006111 regulation of gluconeogenesis Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006493 protein O-linked glycosylation Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010801 negative regulation of peptidyl-threonine phosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G05150

ath:AT2G32450

rno:26295

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.376

Rank 1 · TkA03G324190 · TK1151

Nucleus0.271

Rank 2 · TkA03G324190 · TK1151

Cell membrane0.261

Rank 3 · TkA03G324190 · TK1151

Golgi apparatus0.123

Rank 4 · TkA03G324190 · TK1151

Endoplasmic reticulum0.094

Rank 5 · TkA03G324190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23564EF-hand_FSTL16-44 aa

PF13499EF-hand_79-68 aa

PF13405EF-hand_611-33 aa

PF00036EF-hand_111-35 aa

PF13202EF-hand_514-34 aa

PF12968DUF385620-43 aa

PF24885TPR_NPHP3205-249 aa

PF07719TPR_2214-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G324190	`PF23564`	EF-hand_FSTL1	6	44	0.14	13.3
TkA03G324190	`PF13499`	EF-hand_7	9	68	1.9e-07	32.0
TkA03G324190	`PF13405`	EF-hand_6	11	33	9.7e-05	22.5
TkA03G324190	`PF00036`	EF-hand_1	11	35	9.9e-05	22.3
TkA03G324190	`PF13202`	EF-hand_5	14	34	0.0018	18.4
TkA03G324190	`PF12968`	DUF3856	20	43	0.063	14.0
TkA03G324190	`PF24885`	TPR_NPHP3	205	249	0.022	14.9
TkA03G324190	`PF07719`	TPR_2	214	246	3.6e-32	108.5
TkA03G324190	`PF23914`	TPR_CcmH_CycH	214	247	1.6e-08	35.2
TkA03G324190	`PF00515`	TPR_1	215	246	1.6e-29	101.2
TkA03G324190	`PF13428`	TPR_14	215	254	1.5e-16	60.0
TkA03G324190	`PF13181`	TPR_8	216	245	3.8e-26	89.7
TkA03G324190	`PF12895`	ANAPC3	217	266	5.5e-09	36.9
TkA03G324190	`PF13432`	TPR_16	218	274	6e-22	78.5
TkA03G324190	`PF13424`	TPR_12	218	243	1.6e-18	67.3
TkA03G324190	`PF13176`	TPR_7	218	245	3.1e-11	43.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8L9`	Arabidopsis thaliana	sp\|Q8S8L9\|Y2245_ARATH Uncharacterized TPR repeat-containing protein At2g32450	68.200%	Swiss-Prot	High
`O23052`	Arabidopsis thaliana	sp\|O23052\|Y1515_ARATH Uncharacterized TPR repeat-containing protein At1g05150	68.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card