Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2475 bp · LXL04_030522|LXL04_030522|OH1004|cDNA
ATGTTAATTTTACAGAAGAAAATGTCGACGAGAGGGAGCAGATCGGAGAAGGTAAAGAGGATCTTCCAGCAATTCGATTTGAACAGAGATGGTGGGCTTAACAGAGATGAAATGTCGGCCCTTGTTGTTGCTGTTAACCCTAGAGTTAGATTTAGCGATGAGCAAATTAGTGCTATCCTCGACGAGGTTTTCCGTACGTACGGCGATTTCATCGATACTGATAAAGGTCTTACTTACGATGGGCTGTTACGAACGTACGA...
2475 bp · LXL04_030522|LXL04_030522|OH1004|CDS
ATGTTAATTTTACAGAAGAAAATGTCGACGAGAGGGAGCAGATCGGAGAAGGTAAAGAGGATCTTCCAGCAATTCGATTTGAACAGAGATGGTGGGCTTAACAGAGATGAAATGTCGGCCCTTGTTGTTGCTGTTAACCCTAGAGTTAGATTTAGCGATGAGCAAATTAGTGCTATCCTCGACGAGGTTTTCCGTACGTACGGCGATTTCATCGATACTGATAAAGGTCTTACTTACGATGGGCTGTTACGAACGTACGA...
Protein
Download Protein FASTA824 aa · LXL04_030522|LXL04_030522|OH1004|PROTEIN
MLILQKKMSTRGSRSEKVKRIFQQFDLNRDGGLNRDEMSALVVAVNPRVRFSDEQISAILDEVFRTYGDFIDTDKGLTYDGLLRTYDDGAGDVDRDFEALALELKSDDDNDSNGNNNAHASSMGFEEASTSLVVDERVKSPEPQKQQRKATGAVSPNHGIIFDDTWKLLDDVEILIKRLKAKQLKDSKTKGEHSDAFSDPGWSRELGPSMEMNKQINWDETRHDYTIFVKELGVLRSRADGSRSREEAFDGHMAIGRLLY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030522 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030522 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:118093860-118096521 (-) | |||||||||
| Description | Similar to At1g05150: Uncharacterized TPR repeat-containing protein At1g05150 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000423 mitophagy Biological Process GO:0000432 positive regulation of transcription from RNA polymerase II promoter by glucose Biological Process GO:0001933 negative regulation of protein phosphorylation Biological Process GO:0001934 positive regulation of protein phosphorylation Biological Process GO:0006041 glucosamine metabolic process Biological Process GO:0006110 regulation of glycolytic process Biological Process GO:0006111 regulation of gluconeogenesis Biological Process GO:0006325 chromatin organization Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006493 protein O-linked glycosylation Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0010801 negative regulation of peptidyl-threonine phosphorylation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G05150 ath:AT2G32450 rno:26295 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13499.13EF-hand_716-75 aaPF13414.13TPR_11256-297 aaPF13424.13TPR_12326-386 aaPF23914.2TPR_CcmH_CycH364-458 aaPF13432.13TPR_16365-425 aaPF13414.13TPR_11366-407 aaPF14559.13TPR_19369-415 aaPF29386.1CFAP70_mid_TPR391-453 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_030522 | PF13499.13 | EF-hand_7 | 16 | 75 | 3.7e-06 | 27.9 |
| LXL04_030522 | PF13414.13 | TPR_11 | 256 | 297 | 2.3e-26 | 91.9 |
| LXL04_030522 | PF13424.13 | TPR_12 | 326 | 386 | 1.2e-17 | 64.6 |
| LXL04_030522 | PF23914.2 | TPR_CcmH_CycH | 364 | 458 | 2.9e-07 | 31.2 |
| LXL04_030522 | PF13432.13 | TPR_16 | 365 | 425 | 6.9e-19 | 68.7 |
| LXL04_030522 | PF13414.13 | TPR_11 | 366 | 407 | 2.3e-26 | 91.9 |
| LXL04_030522 | PF14559.13 | TPR_19 | 369 | 415 | 1.3e-18 | 67.8 |
| LXL04_030522 | PF29386.1 | CFAP70_mid_TPR | 391 | 453 | 3.2e-08 | 34.6 |
| LXL04_030522 | PF07719.24 | TPR_2 | 393 | 426 | 1.2e-32 | 110.0 |
| LXL04_030522 | PF00515.35 | TPR_1 | 393 | 425 | 1.4e-30 | 104.5 |
| LXL04_030522 | PF13181.13 | TPR_8 | 394 | 425 | 1.7e-27 | 93.9 |
| LXL04_030522 | PF13424.13 | TPR_12 | 395 | 455 | 1.2e-17 | 64.6 |
| LXL04_030522 | PF29407.1 | CFAP70_TPR_C | 399 | 487 | 3.8e-11 | 43.7 |
| LXL04_030522 | PF13414.13 | TPR_11 | 402 | 441 | 2.3e-26 | 91.9 |
| LXL04_030522 | PF14559.13 | TPR_19 | 410 | 453 | 1.3e-18 | 67.8 |
| LXL04_030522 | PF13431.13 | TPR_17 | 416 | 446 | 5e-17 | 61.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.