TkA03G321320 | RubberDandelionOmics

Gene overview

TkA03G321320

Reference: TK1151 Chr: Chr03 Coordinates: 79002309-79002635 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · TkA03G321320|TK1151|cDNA

ATGGCATCCACTTCAAATTTCGGAATCCCGAATAACGCGAATATACGAAGACAGGGATCGTTGACGTTACCAAGAACACTTAGCCGGAAGTCTGTTGATGAAGTCTGGCGAGAGTTGCAGAAGAGTAACGGCGGAGGAAAAGGCGGCGATTTGATTGGAGAAATTAATTTACAGCGGGAGCAACGGGAGCCTACTTTGGGGGACGACGACGACGACAGAAGAGACAGGGGCCGGCGATGGCGATATCGACGGCAGAAGAG...

CDS

Download CDS FASTA

327 bp · TkA03G321320|TK1151|CDS

ATGGCATCCACTTCAAATTTCGGAATCCCGAATAACGCGAATATACGAAGACAGGGATCGTTGACGTTACCAAGAACACTTAGCCGGAAGTCTGTTGATGAAGTCTGGCGAGAGTTGCAGAAGAGTAACGGCGGAGGAAAAGGCGGCGATTTGATTGGAGAAATTAATTTACAGCGGGAGCAACGGGAGCCTACTTTGGGGGACGACGACGACGACAGAAGAGACAGGGGCCGGCGATGGCGATATCGACGGCAGAAGAG...

Protein

Download Protein FASTA

108 aa · TkA03G321320|TK1151|PROTEIN

MASTSNFGIPNNANIRRQGSLTLPRTLSRKSVDEVWRELQKSNGGGKGGDLIGEINLQREQREPTLGDDDDDRRDRGRRWRYRRQKSKEMVRWETQAGRCKPSAALFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G321320`
TK1151 ID	TkA03G321320
OH-1004 ID	LXL04_010551
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.500
Protein coverage (%)	TK1151 84.259 / OH-1004 36.813 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G321320

Location Chr03:79002309-79002635 (-)

Description Similar to ABF1: ABSCISIC ACID-INSENSITIVE 5-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36270`	Participates in ABA-regulated gene expression during seed development and subsequent vegetative stage by acting as the major mediator of ABA repression of growth.	A postgermination developmental arrest checkpoint is mediated by abscisic acid and requires the ABI5 transcription factor in Arabidopsis.2001 · DOI: 10.1073/pnas.081594298 Regulation of Arabidopsis thaliana Em genes: role of ABI5.2002 · DOI: 10.1046/j.1365-313x.2002.01295.x The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.2002 · DOI: 10.1105/tpc.000869 Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response.2002 · DOI: 10.1104/pp.005793 ABI5 acts downstream of ABI3 to execute an ABA-dependent growth arrest during germination.2002 · DOI: 10.1046/j.1365-313x.2002.01430.x Mitogen-activated protein kinase signaling in postgermination arrest of development by abscisic acid.2002 · DOI: 10.1073/pnas.242607499 Interactions of abscisic acid and sugar signalling in the regulation of leaf senescence.2004 · DOI: 10.1007/s00425-004-1279-5 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5 Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5
`At1g49720`	Binds to the ABA-responsive element (ABRE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0211200`	Transcription factor involved in abscisic acid (ABA) signaling pathway.	Rice ABI5-Like1 regulates abscisic acid and auxin responses by affecting the expression of ABRE-containing genes.2011 · DOI: 10.1104/pp.111.173427 Constitutive activation of transcription factor OsbZIP46 improves drought tolerance in rice.2012 · DOI: 10.1104/pp.111.190389 Functional characterization and reconstitution of ABA signaling components using transient gene expression in rice protoplasts.2015 · DOI: 10.3389/fpls.2015.00614 MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1903648 positive regulation of chlorophyll catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G45249

ath:AT1G49720

ath:AT3G19290

ath:AT3G56850

dosa:Os08g0472000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.469

Rank 1 · TkA03G321320 · TK1151

Cytoplasm0.356

Rank 2 · TkA03G321320 · TK1151

Cell membrane0.222

Rank 3 · TkA03G321320 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA03G321320 · TK1151

Mitochondrion0.058

Rank 5 · TkA03G321320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJN0`	Arabidopsis thaliana	sp\|Q9SJN0\|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5	58.100%	Swiss-Prot	Low
`Q9LES3`	Arabidopsis thaliana	sp\|Q9LES3\|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2	42.900%	Swiss-Prot	Medium
`Q9M7Q4`	Arabidopsis thaliana	sp\|Q9M7Q4\|AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5	53.700%	Swiss-Prot	Low
`Q9M7Q5`	Arabidopsis thaliana	sp\|Q9M7Q5\|AI5L4_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 4	45.200%	Swiss-Prot	Medium
`Q69TW5`	Oryza sativa subsp. japonica	sp\|Q69TW5\|BZP46_ORYSJ bZIP transcription factor 46	50.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card