LXL04_010551 | RubberDandelionOmics

Gene overview

LXL04_010551

Reference: OH-1004 Chr: Chr02 Coordinates: 148926428-148930235 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · LXL04_010551|LXL04_010551|OH1004|cDNA

ATGGATGAGCTATTGAAGAACATCTGGACTGCCGAAGAAACTCAATCAATGGCATCCACTTCAAATTTCGGAATCCCGAATAACGCGAATATACGAAGACAGGGATCGTTGACGTTACCAAGAACACTTAGCCGGAAGTCTGTTGATGAACGGGAGCAACGGGAGCCTACTTTGGGGGACGACGACGACGACAGAAGAGACAGGGGCCGGCGATGGCGATATCGATGGCAGAAGAGCAAGGAGATGGTAAGTGAGGAAGG...

CDS

Download CDS FASTA

549 bp · LXL04_010551|LXL04_010551|OH1004|CDS

ATGGATGAGCTATTGAAGAACATCTGGACTGCCGAAGAAACTCAATCAATGGCATCCACTTCAAATTTCGGAATCCCGAATAACGCGAATATACGAAGACAGGGATCGTTGACGTTACCAAGAACACTTAGCCGGAAGTCTGTTGATGAACGGGAGCAACGGGAGCCTACTTTGGGGGACGACGACGACGACAGAAGAGACAGGGGCCGGCGATGGCGATATCGATGGCAGAAGAGCAAGGAGATGGTAAGTGAGGAAGG...

Protein

Download Protein FASTA

182 aa · LXL04_010551|LXL04_010551|OH1004|PROTEIN

MDELLKNIWTAEETQSMASTSNFGIPNNANIRRQGSLTLPRTLSRKSVDEREQREPTLGDDDDDRRDRGRRWRYRWQKSKEMVSEEGNWTRVRDGVDRGSELTTDEEGVDSEAMRVAPVGRTQRNTPLFRENVLVSVVEEVAGDVGLKQIDVSSFNESTDNRRIPTDSNDASSFRASCVRLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010551`
TK1151 ID	TkA03G321320
OH-1004 ID	LXL04_010551
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.500
Protein coverage (%)	TK1151 84.259 / OH-1004 36.813 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010551

Location Chr02:148926428-148930235 (-)

Description Similar to ABF1: ABSCISIC ACID-INSENSITIVE 5-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49720`	Binds to the ABA-responsive element (ABRE).	No verified direct reference in this release
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5
`At3g19290`	Functions as a transcriptional activator in the ABA-inducible expression of LTI65/RD29B (AC Q04980).	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 Arabidopsis basic leucine zipper proteins that mediate stress-responsive abscisic acid signaling.2002 · DOI: 10.1105/tpc.010362 The effect of ABRE BINDING FACTOR 4-mediated FYVE1 on salt stress tolerance in Arabidopsis.2020 · DOI: 10.1016/j.plantsci.2020.110489
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0472000`	Transcription activator that mediates abscisic acid (ABA) signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010551 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1903648 positive regulation of chlorophyll catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G45249

ath:AT1G49720

ath:AT3G19290

ath:AT3G56850

dosa:Os08g0472000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.380

Rank 1 · LXL04_010551 · OH-1004

Cytoplasm0.367

Rank 2 · LXL04_010551 · OH-1004

Mitochondrion0.185

Rank 3 · LXL04_010551 · OH-1004

Cell membrane0.105

Rank 4 · LXL04_010551 · OH-1004

Golgi apparatus0.047

Rank 5 · LXL04_010551 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7Q5`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 4	57.627%	Swiss-Prot	weak database homology
`Q9M7Q4`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 5	58.929%	Swiss-Prot	weak database homology
`Q9M7Q2`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 7	55.738%	Swiss-Prot	weak database homology
`Q9LES3`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 2	38.158%	Swiss-Prot	weak database homology
`Q6ZDF3`	Oryza sativa subsp. japonica	bZIP transcription factor TRAB1	64.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card