Gene Card
Gene overview
cDNA / CDS / Protein Sequences
727 bp · TkA03G320550|TK1151|cDNA
CAGGCGTCAGACAGATGTGCCTATAAAACAGGGTTCGGTGCTCTTTGGTCTTCATTCATACTTCAAGCTAAAAACGTTTACAACAGCCACACGAATTTGAATTAGGTTTTCTTCGGAGACAAGTTTACGGGAAAAAATGGCGTCGGAGGAAGGAGTTGTGATTGCCTGCCACACTGTTGATCACTGGAAGGAGCAGTTGGAAAAGCACAAGGATCCTAAGAAACTGGTGGTAGTGGATTTCACCGCCACTTGGTGTGGTC...
351 bp · TkA03G320550|TK1151|CDS
ATGGCGTCGGAGGAAGGAGTTGTGATTGCCTGCCACACTGTTGATCACTGGAAGGAGCAGTTGGAAAAGCACAAGGATCCTAAGAAACTGGTGGTAGTGGATTTCACCGCCACTTGGTGTGGTCCATGCCGTATGATTGCACCAATTTTTGCTGAATTAGCTAAAAAGATGACCCATGTTGCCTTCCTTAAGGTCGACGTGGATGAACTTGAGAGCGTTGCTCAGGAGTACTCAGTGGAGGCTATGCCGACATTCTTGTT...
Protein
Download Protein FASTA116 aa · TkA03G320550|TK1151|PROTEIN
MASEEGVVIACHTVDHWKEQLEKHKDPKKLVVVDFTATWCGPCRMIAPIFAELAKKMTHVAFLKVDVDELESVAQEYSVEAMPTFLFLKDGEIVHKVVGAKKDEIVSSVEKYAADA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G320550 |
|---|---|
| TK1151 ID | TkA03G320550 |
| OH-1004 ID | LXL04_008850 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G320550 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:78806720-78807854 (-) | |||||||||
| Description | Similar to TRX1: Thioredoxin H1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006979 response to oxidative stress Biological Process GO:0009409 response to cold Biological Process GO:0010497 plasmodesmata-mediated intercellular transport Biological Process GO:0043085 positive regulation of catalytic activity Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function GO:0008047 enzyme activator activity Molecular Function GO:0015035 protein-disulfide reductase activity Molecular Function GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G51030 nta:107762104 rcu:8266412 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00085Thioredoxin10-110 aaPF10589NADH_4Fe-4S12-24 aaPF13899Thioredoxin_716-88 aaPF02114Phosducin16-98 aaPF13098Thioredoxin_218-109 aaPF00578AhpC-TSA21-85 aaPF14581SseB_C22-79 aaPF14595Thioredoxin_923-91 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G320550 | PF00085 | Thioredoxin | 10 | 110 | 4.7e-31 | 107.5 |
| TkA03G320550 | PF10589 | NADH_4Fe-4S | 12 | 24 | 0.044 | 14.4 |
| TkA03G320550 | PF13899 | Thioredoxin_7 | 16 | 88 | 2.7e-05 | 24.9 |
| TkA03G320550 | PF02114 | Phosducin | 16 | 98 | 0.12 | 12.0 |
| TkA03G320550 | PF13098 | Thioredoxin_2 | 18 | 109 | 1.3e-09 | 39.1 |
| TkA03G320550 | PF00578 | AhpC-TSA | 21 | 85 | 1.9e-05 | 25.3 |
| TkA03G320550 | PF14581 | SseB_C | 22 | 79 | 0.081 | 13.9 |
| TkA03G320550 | PF14595 | Thioredoxin_9 | 23 | 91 | 3.8e-06 | 27.5 |
| TkA03G320550 | PF26967 | A6-like_Thioredoxin-like_C | 24 | 101 | 0.0012 | 19.5 |
| TkA03G320550 | PF02966 | DIM1 | 25 | 105 | 0.046 | 14.2 |
| TkA03G320550 | PF08534 | Redoxin | 28 | 57 | 6.4e-05 | 23.5 |
| TkA03G320550 | PF13905 | Thioredoxin_8 | 29 | 72 | 1.3e-05 | 26.2 |
| TkA03G320550 | PF20207 | PedC-like | 29 | 105 | 0.00024 | 21.8 |
| TkA03G320550 | PF04756 | OST3_OST6 | 31 | 90 | 0.00014 | 22.1 |
| TkA03G320550 | PF00462 | Glutaredoxin | 33 | 76 | 0.045 | 14.7 |
| TkA03G320550 | PF10589 | NADH_4Fe-4S | 36 | 76 | 0.044 | 14.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.