LXL04_008850 | RubberDandelionOmics

Gene overview

LXL04_008850

Reference: OH-1004 Chr: Chr02 Coordinates: 110401754-110402512 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

351 bp · LXL04_008850|LXL04_008850|OH1004|cDNA

ATGGCGTCGGAGGAAGGAGTTGTGATTGCCTGCCACACTGTTGATCACTGGAAGGAGCAGTTGGAAAAGCACAAGGATCCTAAGAAACTGGTGGTAGTGGATTTCACCGCCACTTGGTGTGGTCCATGCCGTATGATTGCACCAATTTTTGCTGAATTAGCTAAAAAGATGACCCATGTTGCCTTCCTTAAGGTCGACGTGGATGAACTTGAGAGCGTTGCTCAGGAGTACTCAGTGGAGGCTATGCCGACATTCTTGTT...

CDS

Download CDS FASTA

351 bp · LXL04_008850|LXL04_008850|OH1004|CDS

ATGGCGTCGGAGGAAGGAGTTGTGATTGCCTGCCACACTGTTGATCACTGGAAGGAGCAGTTGGAAAAGCACAAGGATCCTAAGAAACTGGTGGTAGTGGATTTCACCGCCACTTGGTGTGGTCCATGCCGTATGATTGCACCAATTTTTGCTGAATTAGCTAAAAAGATGACCCATGTTGCCTTCCTTAAGGTCGACGTGGATGAACTTGAGAGCGTTGCTCAGGAGTACTCAGTGGAGGCTATGCCGACATTCTTGTT...

Protein

Download Protein FASTA

116 aa · LXL04_008850|LXL04_008850|OH1004|PROTEIN

MASEEGVVIACHTVDHWKEQLEKHKDPKKLVVVDFTATWCGPCRMIAPIFAELAKKMTHVAFLKVDVDELESVAQEYSVEAMPTFLFLKDGEIVHKVVGAKKDEIVSSVEKYAADA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008850`
TK1151 ID	TkA03G320550
OH-1004 ID	LXL04_008850
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008850

Location Chr02:110401754-110402512 (+)

Description Similar to TRX1: Thioredoxin H1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51030`	Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YIW7`	Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008850 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0008047 enzyme activator activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT3G51030

nta:107762104

rcu:8266412

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.731

Rank 1 · LXL04_008850 · OH-1004

Nucleus0.357

Rank 2 · LXL04_008850 · OH-1004

Mitochondrion0.119

Rank 3 · LXL04_008850 · OH-1004

Cell membrane0.110

Rank 4 · LXL04_008850 · OH-1004

Endoplasmic reticulum0.104

Rank 5 · LXL04_008850 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin10-110 aa

PF13098.14Thioredoxin_218-109 aa

PF14595.13Thioredoxin_923-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008850	`PF00085.27`	Thioredoxin	10	110	4.7e-31	107.5
LXL04_008850	`PF13098.14`	Thioredoxin_2	18	109	1.3e-09	39.1
LXL04_008850	`PF14595.13`	Thioredoxin_9	23	91	3.8e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29448`	Arabidopsis thaliana	Thioredoxin H1	66.667%	Swiss-Prot	strong database homology
`A2YIW7`	Oryza sativa subsp. indica	Thioredoxin H-type	60.714%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card