TkA03G304740 | RubberDandelionOmics

Gene overview

TkA03G304740

Reference: TK1151 Chr: Chr03 Coordinates: 74952186-74952959 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · TkA03G304740|TK1151|cDNA

ATGGAACCCCATCAATCAGACCTCTCATCTGCACTAATCAAAACAAAATCAAGCACCACGAAAGATAACCGAGACTTTCTAATCCACCTCGAAGCATACCTCGCCAAACGGGACGGCGTCGACAAGCTCCTGAAGATCTCTCGATACGCCACCAAAATCATCCTATCCTCCGACTTCATACCCACCACCCACCCCCTCCACCTCCGCCTGAAGAGCTTCGACTCCAGCGTTGGACTCAGCCGTAAAGCTTTCCGCCTCGG...

CDS

Download CDS FASTA

774 bp · TkA03G304740|TK1151|CDS

ATGGAACCCCATCAATCAGACCTCTCATCTGCACTAATCAAAACAAAATCAAGCACCACGAAAGATAACCGAGACTTTCTAATCCACCTCGAAGCATACCTCGCCAAACGGGACGGCGTCGACAAGCTCCTGAAGATCTCTCGATACGCCACCAAAATCATCCTATCCTCCGACTTCATACCCACCACCCACCCCCTCCACCTCCGCCTGAAGAGCTTCGACTCCAGCGTTGGACTCAGCCGTAAAGCTTTCCGCCTCGG...

Protein

Download Protein FASTA

257 aa · TkA03G304740|TK1151|PROTEIN

MEPHQSDLSSALIKTKSSTTKDNRDFLIHLEAYLAKRDGVDKLLKISRYATKIILSSDFIPTTHPLHLRLKSFDSSVGLSRKAFRLGKFIQDVNSFRSAELETRQDLILAILAYGGEGLYYFVEQFVWLAKSGLIDGKHSRNLQRISAWAEFIGYIGSITLKTRDLKGISKDEACLLSSIEIMVTRGDSTKTEEEKLKKLREKKLLKKLSVVQDVADGLMAVADIRDGKGRLSGPLLMASAGMLSAIISTHKNWQSC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G304740`
TK1151 ID	TkA03G304740
OH-1004 ID	LXL04_012049
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	30.300
Protein coverage (%)	TK1151 87.549 / OH-1004 96.018 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G304740

Location Chr03:74952186-74952959 (+)

Description Similar to PEX11-4: Peroxisomal membrane protein 11-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47750`	Involved in peroxisomal proliferation.	Five Arabidopsis peroxin 11 homologs individually promote peroxisome elongation, duplication or aggregation.2006 · DOI: 10.1242/jcs.02904 The PEROXIN11 protein family controls peroxisome proliferation in Arabidopsis.2007 · DOI: 10.1105/tpc.106.045831

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFQ8`	Involved in peroxisomal proliferation.	No verified direct reference in this release
`Os03g0302000`	Involved in peroxisomal proliferation.	No verified direct reference in this release
`Os03g0301950`	Involved in peroxisomal proliferation.	No verified direct reference in this release
`UniProt: Q01IH3`	Involved in peroxisomal proliferation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012049 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007031 peroxisome organization Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0044375 regulation of peroxisome size Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G47430

dosa:Os03g0302000

dosa:Os04g0534600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.752

Rank 1 · TkA03G304740 · TK1151

Mitochondrion0.145

Rank 2 · TkA03G304740 · TK1151

Cytoplasm0.069

Rank 3 · TkA03G304740 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA03G304740 · TK1151

Plastid0.048

Rank 5 · TkA03G304740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05648PEX1129-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G304740	`PF05648`	PEX11	29	254	1.9e-43	149.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF1`	Arabidopsis thaliana	sp\|Q9FZF1\|PX11A_ARATH Peroxisomal membrane protein 11A	64.400%	Swiss-Prot	High
`A2XFQ8`	Oryza sativa subsp. indica	sp\|A2XFQ8\|PX113_ORYSI Peroxisomal membrane protein 11-3	56.400%	Swiss-Prot	High
`Q10MN2`	Oryza sativa subsp. japonica	sp\|Q10MN2\|PX113_ORYSJ Peroxisomal membrane protein 11-3	56.400%	Swiss-Prot	High
`Q10MN3`	Oryza sativa subsp. japonica	sp\|Q10MN3\|PX112_ORYSJ Peroxisomal membrane protein 11-2	47.800%	Swiss-Prot	Medium
`Q01IH3`	Oryza sativa subsp. indica	sp\|Q01IH3\|PX114_ORYSI Peroxisomal membrane protein 11-4	32.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card