LXL04_012049 | RubberDandelionOmics

Gene overview

LXL04_012049

Reference: OH-1004 Chr: Chr03 Coordinates: 5570128-5570808 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · LXL04_012049|LXL04_012049|OH1004|cDNA

ATGAATGACAAAGTAGACAAGTTAGTTATCTTCCTAGCAAAAAGAGATGGCATTGACAAGCTTGTCAAAACCTTCCAATATGTCTCTAAACTCCTCGTCTGGCACCTCGAAACCACCAATCCAAACGCAGCCCATCGAGCCAAGCAGTGCGAGGTGGCATCAGGGTTGAGCCGGAAAGCCTTCAGGGCGGGACGGTTTCTCACAGGCTTCAATGCACTGAGGAGAACCCCTGGCCCAACCCCGACTTACAGGGTTCTCTC...

CDS

Download CDS FASTA

681 bp · LXL04_012049|LXL04_012049|OH1004|CDS

ATGAATGACAAAGTAGACAAGTTAGTTATCTTCCTAGCAAAAAGAGATGGCATTGACAAGCTTGTCAAAACCTTCCAATATGTCTCTAAACTCCTCGTCTGGCACCTCGAAACCACCAATCCAAACGCAGCCCATCGAGCCAAGCAGTGCGAGGTGGCATCAGGGTTGAGCCGGAAAGCCTTCAGGGCGGGACGGTTTCTCACAGGCTTCAATGCACTGAGGAGAACCCCTGGCCCAACCCCGACTTACAGGGTTCTCTC...

Protein

Download Protein FASTA

226 aa · LXL04_012049|LXL04_012049|OH1004|PROTEIN

MNDKVDKLVIFLAKRDGIDKLVKTFQYVSKLLVWHLETTNPNAAHRAKQCEVASGLSRKAFRAGRFLTGFNALRRTPGPTPTYRVLSIYANAGEMVYLFFDHFLWLSRIGVLNANLARRMSFISAFGESVGYVFFCVIEFIMIKQGIEEERRIRRGLLSDSMEKGDEIKKIKVDRVMRLMAVSANLADLIIALADIEPNPFCNHAITLGISGLVSAWAGWYRNWPT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012049`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012049

Location Chr03:5570128-5570808 (+)

Description Similar to PEX11-4: Peroxisomal membrane protein 11-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47430`	Involved in peroxisomal proliferation.	Five Arabidopsis peroxin 11 homologs individually promote peroxisome elongation, duplication or aggregation.2006 · DOI: 10.1242/jcs.02904 The PEROXIN11 protein family controls peroxisome proliferation in Arabidopsis.2007 · DOI: 10.1105/tpc.106.045831

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0534600`	Involved in peroxisomal proliferation.	No verified direct reference in this release
`UniProt: Q01IH3`	Involved in peroxisomal proliferation.	No verified direct reference in this release
`Os03g0302000`	Involved in peroxisomal proliferation.	No verified direct reference in this release
`UniProt: A2XFQ8`	Involved in peroxisomal proliferation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012049 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007031 peroxisome organization Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0044375 regulation of peroxisome size Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G47430

dosa:Os03g0302000

dosa:Os04g0534600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.790

Rank 1 · LXL04_012049 · OH-1004

Mitochondrion0.148

Rank 2 · LXL04_012049 · OH-1004

Cytoplasm0.060

Rank 3 · LXL04_012049 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_012049 · OH-1004

Nucleus0.034

Rank 5 · LXL04_012049 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05648.20PEX115-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012049	`PF05648.20`	PEX11	5	224	6.1e-57	193.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STY0`	Arabidopsis thaliana	Peroxisomal membrane protein 11B	68.304%	Swiss-Prot	strong database homology
`Q7XU74`	Oryza sativa subsp. japonica	Peroxisomal membrane protein 11-4	68.000%	Swiss-Prot	strong database homology
`Q01IH3`	Oryza sativa subsp. indica	Peroxisomal membrane protein 11-4	68.000%	Swiss-Prot	strong database homology
`Q10MN2`	Oryza sativa subsp. japonica	Peroxisomal membrane protein 11-3	33.488%	Swiss-Prot	moderate database homology
`A2XFQ8`	Oryza sativa subsp. indica	Peroxisomal membrane protein 11-3	33.488%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card