TkA03G289300 | RubberDandelionOmics

Gene overview

TkA03G289300

Reference: TK1151 Chr: Chr03 Coordinates: 71357195-71362005 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2584 bp · TkA03G289300|TK1151|cDNA

TTTTTATAAGTCGATATCAAAAAGTGATTTTACTATCTGATTCTGAACTGCGAATTGACATTTATACAATTATAGACCTAGTACCCTCAAAACTTACGCCTCCACAAAACGCACAACCCATTCACGTCGCCGTCTGTGCCTGCTGCCGCCCTCCGTCGATCAGAGCCACCGGCGGCCACCTCCCCCACTACAGACGCCGCAATCCAGCTCGTAGGTCTCGCTTCATCTTCGATTGAGCCCCTGGTACAGTCTTAATCTGC...

CDS

Download CDS FASTA

1488 bp · TkA03G289300|TK1151|CDS

ATGTCAGTGGCGGGATCTTGGAGTCAGAATGCAATTCATGCCACAAATGCATGGCTGAAAGAAGGGTTAAGGCAACGTTGTATTACTAGGGATTTGAAGTGGGGTGTCCCTGTACCCCTTGACAAATTTAAAGAAAAGGTTTTCTATGTATGGTTTGATGCACCTATTGGATACGTGTCTATTACAAAATGTTACACACCTGAGTGGGAGAAGTGGTGGAAAAATCCTGAAAATGTGGAGCTTTTTCAGTTTATGGGAAA...

Protein

Download Protein FASTA

495 aa · TkA03G289300|TK1151|PROTEIN

MSVAGSWSQNAIHATNAWLKEGLRQRCITRDLKWGVPVPLDKFKEKVFYVWFDAPIGYVSITKCYTPEWEKWWKNPENVELFQFMGKDNVPFHTVMFPSTLLGTEESWTMMKTISVTEYLNYETGKFSKSKGVGVFGNDAKDTNIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLSFIAKDPSTGYGFIIPDAPDAQSHSLTKNLEIKLATMFTNIDAMEKVKLKQGLKIAMSISGEGNAYLQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G289300`
TK1151 ID	TkA03G289300
OH-1004 ID	LXL04_008351
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.700
Protein coverage (%)	TK1151 100.000 / OH-1004 72.376 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G289300

Location Chr03:71357195-71362005 (-)

Description Similar to Os06g0508700: Probable methionine--tRNA ligase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13780`	Methionine--tRNA ligase, cytoplasmic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0508700`	Probable methionine--tRNA ligase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006431 methionyl-tRNA aminoacylation Biological Process

GO:0009303 rRNA transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0036120 cellular response to platelet-derived growth factor stimulus Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0071364 cellular response to epidermal growth factor stimulus Biological Process

GO:1901838 positive regulation of transcription of nucleolar large rRNA by RNA polymerase I Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0017101 aminoacyl-tRNA synthetase multienzyme complex Cellular Component

KEGG gene cross-reference

ath:AT4G13780

ddi:DDB_G0279113

mmu:216443

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA03G289300 · TK1151

Nucleus0.192

Rank 2 · TkA03G289300 · TK1151

Mitochondrion0.140

Rank 3 · TkA03G289300 · TK1151

Peroxisome0.099

Rank 4 · TkA03G289300 · TK1151

Cell membrane0.070

Rank 5 · TkA03G289300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09334tRNA-synt_1g6-191 aa

PF19303Anticodon_3212-316 aa

PF24685OB_RRP5_4th360-396 aa

PF01588tRNA_bind368-452 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G289300	`PF09334`	tRNA-synt_1g	6	191	2.3e-69	234.8
TkA03G289300	`PF19303`	Anticodon_3	212	316	2.8e-10	41.0
TkA03G289300	`PF24685`	OB_RRP5_4th	360	396	0.13	13.0
TkA03G289300	`PF01588`	tRNA_bind	368	452	1.1e-29	103.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVN5`	Arabidopsis thaliana	sp\|Q9SVN5\|SYMC_ARATH Methionine--tRNA ligase, cytoplasmic	63.700%	Swiss-Prot	High
`Q9ZTS1`	Oryza sativa subsp. japonica	sp\|Q9ZTS1\|SYM_ORYSJ Probable methionine--tRNA ligase	66.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card