TkA03G287930 | RubberDandelionOmics

Gene overview

TkA03G287930

Reference: TK1151 Chr: Chr03 Coordinates: 71070665-71072300 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1244 bp · TkA03G287930|TK1151|cDNA

TTAACTGTGACTATATATACACAATATACAGATGTTATATGTACATGTATATCTCCATATTACTTACACATAACGATGGCTTTAGAATATCAATCTTCCAATGCTTCTGATCCCTATAAGCACCTCAATATCACCCCGAACCGGATGGCACTTTGACCCGACATGTTTCCTTTCCAACCTTATCGGCCGAACCTAAACTAACCACCGATAACCAAATCACCCTGTCCAAAGACATCCCACTCAACCCCACCACCGCCACC...

CDS

Download CDS FASTA

714 bp · TkA03G287930|TK1151|CDS

ATGAGCGCCACCTCTGGTCCCATACACGTTATATGCTCAGAAATGGCAGCTCAGTGTCCGACAATCGTTATAAATGTGGAATATCGTCTTGGCCCAGAACACCGTCTGCCTGCAGCATATGATGACGGGGTTGACGTTATCCAGTGGGTGCGTGACCAGGCGTTGAGAACCGGACACGGAGGTGGCGAGGAGTGGTTGACTAAATTCGCTGACTTTTCGAGAGTCTACTTAATGGGTACTAGTGCAGGAGGAAATTTAAT...

Protein

Download Protein FASTA

237 aa · TkA03G287930|TK1151|PROTEIN

MSATSGPIHVICSEMAAQCPTIVINVEYRLGPEHRLPAAYDDGVDVIQWVRDQALRTGHGGGEEWLTKFADFSRVYLMGTSAGGNLIYNVGLHALDLELDPVKIKGLIIDQPFFGGIDRTEAELRLVNDYIIPLTTSDLLWSLALPLDADRDNRYCNPLGDRHASYKEKIGRLPKSLNRLHGKDPMIDRQKDFANMLELCGVDVTRKFYEEAYHCVEVFDPEKAQILYDDVKKFIYN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G287930`
TK1151 ID	TkA03G287930
OH-1004 ID	LXL04_026803
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 72.477 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G287930

Location Chr03:71070665-71072300 (+)

Description Similar to CXE8: Probable carboxylesterase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45600`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At5g62180`	Carboxylesterase that possesses esterase activity in vitro with the synthetic substrate p-nitrophenyl acetate (pNPA).	Arabidopsis Carboxylesterase 20 Binds Strigolactone and Increases Branches and Tillers When Ectopically Expressed in Arabidopsis and Maize.2021 · DOI: 10.3389/fpls.2021.639401 Structural insights into strigolactone catabolism by carboxylesterases reveal a conserved conformational regulation.2024 · DOI: 10.1038/s41467-024-50928-3
`At2g45610`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026803 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009820 alkaloid metabolic process Biological Process

GO:1901600 strigolactone metabolic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0043722 4-hydroxyphenylacetate decarboxylase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT2G45600

ath:AT2G45610

ath:AT5G62180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.808

Rank 1 · TkA03G287930 · TK1151

Nucleus0.304

Rank 2 · TkA03G287930 · TK1151

Endoplasmic reticulum0.057

Rank 3 · TkA03G287930 · TK1151

Peroxisome0.047

Rank 4 · TkA03G287930 · TK1151

Cell membrane0.040

Rank 5 · TkA03G287930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07859Abhydrolase_39-216 aa

PF20434BD-FAE22-96 aa

PF10340Say1_Mug18065-92 aa

PF12146Hydrolase_474-117 aa

PF12146Hydrolase_4182-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G287930	`PF07859`	Abhydrolase_3	9	216	1.9e-43	149.4
TkA03G287930	`PF20434`	BD-FAE	22	96	3.3e-06	27.5
TkA03G287930	`PF10340`	Say1_Mug180	65	92	0.011	15.3
TkA03G287930	`PF12146`	Hydrolase_4	74	117	0.034	14.2
TkA03G287930	`PF12146`	Hydrolase_4	182	216	0.034	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64640`	Arabidopsis thaliana	sp\|O64640\|CXE8_ARATH Probable carboxylesterase 8	48.100%	Swiss-Prot	Medium
`Q9LVB8`	Arabidopsis thaliana	sp\|Q9LVB8\|CXE20_ARATH Carboxylesterase 20	45.300%	Swiss-Prot	Medium
`O64641`	Arabidopsis thaliana	sp\|O64641\|CXE9_ARATH Probable carboxylesterase 9	44.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card