LXL04_026803 | RubberDandelionOmics

Gene overview

LXL04_026803

Reference: OH-1004 Chr: Chr06 Coordinates: 3070212-3071599 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · LXL04_026803|LXL04_026803|OH1004|cDNA

ATGGCTTTAGAATATCAATCTTCCAATGCTTCTGATCCCTATAAGCACCTCAATATCACCCCGAACCCGGATGGCACTTTGACCCGACATGTTTCCTTTCCAACCTTATCGGCCGAACCTAAACTAACCACCGATAACCAAATCACCCTGTCCAAAGACATCCCACTCAACCCCACCACCGCCACCTTCCTCCGCATCTACCGCCCTGTCTCTCCGCCCTCTAAAAAACTCCCTATCATCATCTATTTCCACCCTGGCGG...

CDS

Download CDS FASTA

984 bp · LXL04_026803|LXL04_026803|OH1004|CDS

ATGGCTTTAGAATATCAATCTTCCAATGCTTCTGATCCCTATAAGCACCTCAATATCACCCCGAACCCGGATGGCACTTTGACCCGACATGTTTCCTTTCCAACCTTATCGGCCGAACCTAAACTAACCACCGATAACCAAATCACCCTGTCCAAAGACATCCCACTCAACCCCACCACCGCCACCTTCCTCCGCATCTACCGCCCTGTCTCTCCGCCCTCTAAAAAACTCCCTATCATCATCTATTTCCACCCTGGCGG...

Protein

Download Protein FASTA

327 aa · LXL04_026803|LXL04_026803|OH1004|PROTEIN

MALEYQSSNASDPYKHLNITPNPDGTLTRHVSFPTLSAEPKLTTDNQITLSKDIPLNPTTATFLRIYRPVSPPSKKLPIIIYFHPGGFVVMSATSGPIHVICSEMAAQCPTIVINVEYRLGPEHRLPAAYDDGVDVIQWVRDQALRTGHGGGEEWLTKFADFSRVYLMGTSAGGNLIYNVGLHALDLELDPVKIKGLIIDQPFFGGIDRTEAELRLVNDYIIPLTTSDLLWSLALPLDADRDNRYCNPLGDRHASYKEKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026803`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026803

Location Chr06:3070212-3071599 (-)

Description Similar to CXE8: Probable carboxylesterase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45600`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At5g62180`	Carboxylesterase that possesses esterase activity in vitro with the synthetic substrate p-nitrophenyl acetate (pNPA).	Arabidopsis Carboxylesterase 20 Binds Strigolactone and Increases Branches and Tillers When Ectopically Expressed in Arabidopsis and Maize.2021 · DOI: 10.3389/fpls.2021.639401 Structural insights into strigolactone catabolism by carboxylesterases reveal a conserved conformational regulation.2024 · DOI: 10.1038/s41467-024-50928-3
`At2g45610`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026803 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009820 alkaloid metabolic process Biological Process

GO:1901600 strigolactone metabolic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0043722 4-hydroxyphenylacetate decarboxylase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT2G45600

ath:AT2G45610

ath:AT5G62180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.814

Rank 1 · LXL04_026803 · OH-1004

Nucleus0.316

Rank 2 · LXL04_026803 · OH-1004

Peroxisome0.061

Rank 3 · LXL04_026803 · OH-1004

Mitochondrion0.045

Rank 4 · LXL04_026803 · OH-1004

Endoplasmic reticulum0.042

Rank 5 · LXL04_026803 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00135.35COesterase64-122 aa

PF20434.6BD-FAE66-186 aa

PF07859.20Abhydrolase_380-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026803	`PF00135.35`	COesterase	64	122	6.5e-07	29.4
LXL04_026803	`PF20434.6`	BD-FAE	66	186	1.4e-09	38.5
LXL04_026803	`PF07859.20`	Abhydrolase_3	80	306	2.7e-49	168.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64640`	Arabidopsis thaliana	Probable carboxylesterase 8	49.371%	Swiss-Prot	moderate database homology
`Q9LVB8`	Arabidopsis thaliana	Carboxylesterase 20	43.976%	Swiss-Prot	moderate database homology
`O64641`	Arabidopsis thaliana	Probable carboxylesterase 9	42.073%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card