TkA03G284500 | RubberDandelionOmics

Gene overview

TkA03G284500

Reference: TK1151 Chr: Chr03 Coordinates: 70205967-70207624 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1069 bp · TkA03G284500|TK1151|cDNA

TTCCCACTTTCCCCACTACCAACTGCAAGTCTGCAACTTCCGACGTCTGTAAACCTTCCAAGGTTTGAACTTGAAACCTCATACGTATGAGGTGCTAAGCTTTACCAGTTGAGCACCGCCATAGTGACCGAGTATCATTTTCCTTCATCGCCTTTGAAGTGCATTTAATTTTGCCGTATGTAAATTTATGTTTCGACCGGAATAATCCCCAACTGTGACCGACTTTTAAACCTCGAGTGATCAGCTCAACGGCGGAAAAA...

CDS

Download CDS FASTA

618 bp · TkA03G284500|TK1151|CDS

ATGTCAGAATTCTATGCGGCGGAGACGGCGACAACCGCCACCGTCAGATCACAGACGGAGTATATGAAGGGAAATGAGAAGAAGATTGTAGAAACGAACATTAACCAAGCTTGGGCATCTATTCAGACCGGAGTCTTCGATAATCCATTGGTTTACACCCAAACCTGTACTACTTTAGGAAGCACTATCGATTCAGCTATCGCGACAAATGCAGTTCCATCATCATCTCATCTGCCTCAGCTACATTTGATTGTTAGAGA...

Protein

Download Protein FASTA

206 aa · TkA03G284500|TK1151|PROTEIN

MSEFYAAETATTATVRSQTEYMKGNEKKIVETNINQAWASIQTGVFDNPLVYTQTCTTLGSTIDSAIATNAVPSSSHLPQLHLIVREVYRLMAELQQPSLMLLMLPIKAACKVGWFPDGVKADLLMMADKVCSMFSDTDKMRIEPSYVHSCVPKIILRFYPTMKVETILTSFNVKAGYGTFVVDFHISQGTLPRQCRNLWLLVARM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G284500`
TK1151 ID	TkA03G284500
OH-1004 ID	LXL04_026691
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 37.660 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G284500

Location Chr03:70205967-70207624 (+)

Description Similar to PIAL2: E4 SUMO-protein ligase PIAL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08910`	Together with MOM1 and PIAL2, regulates transcriptional gene silencing (TGS) independently of changes in DNA methylation.	Arabidopsis PIAL1 and 2 promote SUMO chain formation as E4-type SUMO ligases and are involved in stress responses and sulfur metabolism.2014 · DOI: 10.1105/tpc.114.131300 The SUMO E3 Ligase-Like Proteins PIAL1 and PIAL2 Interact with MOM1 and Form a Novel Complex Required for Transcriptional Silencing.2016 · DOI: 10.1105/tpc.15.00997

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026691 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007259 cell surface receptor signaling pathway via JAK-STAT Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032480 negative regulation of type I interferon production Biological Process

GO:0033235 positive regulation of protein sumoylation Biological Process

KEGG gene cross-reference

ath:AT1G08910

ath:AT5G41580

dre:406712

hsa:8554

sce:YOR156C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.386

Rank 1 · TkA03G284500 · TK1151

Nucleus0.233

Rank 2 · TkA03G284500 · TK1151

Cytoplasm0.169

Rank 3 · TkA03G284500 · TK1151

Plastid0.163

Rank 4 · TkA03G284500 · TK1151

Cell membrane0.044

Rank 5 · TkA03G284500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21208euk_SelB_III14-71 aa

PF26716PIAL1_N30-177 aa

PF26716PIAL1_N183-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G284500	`PF21208`	euk_SelB_III	14	71	0.1	13.9
TkA03G284500	`PF26716`	PIAL1_N	30	177	3.8e-41	141.2
TkA03G284500	`PF26716`	PIAL1_N	183	203	3.8e-41	141.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A0A7EPL0`	Arabidopsis thaliana	sp\|A0A0A7EPL0\|PIAL1_ARATH E4 SUMO-protein ligase PIAL1	31.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card