TkA03G220440 | RubberDandelionOmics

Gene overview

TkA03G220440

Reference: TK1151 Chr: Chr03 Coordinates: 55129153-55131577 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA03G220440|TK1151|cDNA

ATGGTGGACGACGAGAAGCTGGTCTTTGAGACCTCGCGTGGAGTGGAGCCCATCATGAGCTTTGACCAGATGGGTATCAAAGACGATCTGCTCCCTGGGATTTACCAACACAGATTCGAGAAACCCTCGGCAATTCAACAGAGAGCTGTTTGGCCTATCGTTGAAGGCCGTGATGTCATTGCTCAGGCTCAATCTGACTTTTTTTTCATCCAGATTCCATGGGAACCACCAAAGGATGGATTAAAAGGTTTCTTTGCATC...

CDS

Download CDS FASTA

504 bp · TkA03G220440|TK1151|CDS

ATGGTGGACGACGAGAAGCTGGTCTTTGAGACCTCGCGTGGAGTGGAGCCCATCATGAGCTTTGACCAGATGGGTATCAAAGACGATCTGCTCCCTGGGATTTACCAACACAGATTCGAGAAACCCTCGGCAATTCAACAGAGAGCTGTTTGGCCTATCGTTGAAGGCCGTGATGTCATTGCTCAGGCTCAATCTGACTTTTTTTTCATCCAGATTCCATGGGAACCACCAAAGGATGGATTAAAAGGTTTCTTTGCATC...

Protein

Download Protein FASTA

167 aa · TkA03G220440|TK1151|PROTEIN

MVDDEKLVFETSRGVEPIMSFDQMGIKDDLLPGIYQHRFEKPSAIQQRAVWPIVEGRDVIAQAQSDFFFIQIPWEPPKDGLKGFFASIEEMFFKLWYGMVEFITGRSCSKKCTGLFDFHFHIRYLCMKWLLMFGSVFAIFPTVIVLLWLLHENGVFDPLYEWWEDHF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G220440`
TK1151 ID	TkA03G220440
OH-1004 ID	LXL04_026479
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 57.485 / OH-1004 13.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G220440

Location Chr03:55129153-55131577 (+)

Description Similar to HAP2: Protein HAPLESS 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11720`	Required for male fertility.	Arabidopsis HAP2 (GCS1) is a sperm-specific gene required for pollen tube guidance and fertilization.2006 · DOI: 10.1242/dev.02683 HAP2(GCS1)-dependent gamete fusion requires a positively charged carboxy-terminal domain.2010 · DOI: 10.1371/journal.pgen.1000882 The functional domain of GCS1-based gamete fusion resides in the amino terminus in plant and parasite species.2010 · DOI: 10.1371/journal.pone.0015957 Egg cell-secreted EC1 triggers sperm cell activation during double fertilization.2012 · DOI: 10.1126/science.1223944 Arabidopsis HAP2/GCS1 is a gamete fusion protein homologous to somatic and viral fusogens.2017 · DOI: 10.1083/jcb.201610093
`At3g19760`	ATP-dependent RNA helicase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0639100`	ATP-dependent RNA helicase.	No verified direct reference in this release
`Os03g0566800`	ATP-dependent RNA helicase.	Two highly similar DEAD box proteins, OsRH2 and OsRH34, homologous to eukaryotic initiation factor 4AIII, play roles of the exon junction complex in regulating growth and development in rice.2016 · DOI: 10.1186/s12870-016-0769-5

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026479 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007338 single fertilization Biological Process

GO:0007342 fusion of sperm to egg plasma membrane involved in single fertilization Biological Process

GO:0009566 fertilization Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0045026 plasma membrane fusion Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0051205 protein insertion into membrane Biological Process

GO:0061936 fusion of sperm to egg plasma membrane involved in double fertilization forming a zygote and endosperm Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT4G11720

dosa:Os09g0525700

nve:5507857

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.249

Rank 1 · TkA03G220440 · TK1151

Cytoplasm0.164

Rank 2 · TkA03G220440 · TK1151

Golgi apparatus0.163

Rank 3 · TkA03G220440 · TK1151

Extracellular0.157

Rank 4 · TkA03G220440 · TK1151

Mitochondrion0.127

Rank 5 · TkA03G220440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JP36`	Arabidopsis thaliana	sp\|F4JP36\|HAP2_ARATH Protein HAPLESS 2	51.600%	Swiss-Prot	Medium
`Q94A52`	Arabidopsis thaliana	sp\|Q94A52\|RH2_ARATH Eukaryotic initiation factor 4A-III homolog	71.900%	Swiss-Prot	Low
`Q5VNM3`	Oryza sativa subsp. japonica	sp\|Q5VNM3\|IF43A_ORYSJ Eukaryotic initiation factor 4A-III homolog A	78.100%	Swiss-Prot	Low
`Q10I26`	Oryza sativa subsp. japonica	sp\|Q10I26\|IF43B_ORYSJ Eukaryotic initiation factor 4A-III homolog B	76.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card