Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1680 bp · TkA03G197250|TK1151|cDNA
ATGTCAGAGAGTTCCGCAGAGCTGTCTCTGCGGAATGGACATAACTCTCGCGGAACTTTGTGCGAGTTTCAAGACTCGGGTGAAGCCAAACAAACATTTGCTCAGGCAAAAGAAGAAGAGCTTTCTTATCCTCCGCTCAGACCGCCGGCTGTCTCCGAAACTGACGAACTCCCAGTAACCACCATGCCTACCGCCTGCAACTACCACCACCTCCTCTCCTCTACGTTCGTTATCCAAATCCCTAGTAAGTTCACAAAACA...
1680 bp · TkA03G197250|TK1151|CDS
ATGTCAGAGAGTTCCGCAGAGCTGTCTCTGCGGAATGGACATAACTCTCGCGGAACTTTGTGCGAGTTTCAAGACTCGGGTGAAGCCAAACAAACATTTGCTCAGGCAAAAGAAGAAGAGCTTTCTTATCCTCCGCTCAGACCGCCGGCTGTCTCCGAAACTGACGAACTCCCAGTAACCACCATGCCTACCGCCTGCAACTACCACCACCTCCTCTCCTCTACGTTCGTTATCCAAATCCCTAGTAAGTTCACAAAACA...
Protein
Download Protein FASTA559 aa · TkA03G197250|TK1151|PROTEIN
MSESSAELSLRNGHNSRGTLCEFQDSGEAKQTFAQAKEEELSYPPLRPPAVSETDELPVTTMPTACNYHHLLSSTFVIQIPSKFTKHHSITVFKSPATNILNPILGCSKKSSMDGPKKTSRRSPRKYGSSRKSVLRKTFKQEQVTFTAPISDDPVVAIIGGGMSGLLCALQLEKRGVRSTVFDTGIHGLGGRLGTRMIDPSMIFDHAAQFFTVSNPLFSELVDEWSHKGYVRESVGVIGELEAGGDFFPFPPSPPRYIAV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G197250 |
|---|---|
| TK1151 ID | TkA03G197250 |
| OH-1004 ID | LXL04_007615 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.200 |
| Protein coverage (%) | TK1151 91.055 / OH-1004 96.139Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G197250 |
|---|---|
| Location | Chr03:49516874-49521138 (+) |
| Description | Similar to PSPTO_1126: Renalase (Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002931 response to ischemia Biological Process GO:0003073 regulation of systemic arterial blood pressure Biological Process GO:0010459 negative regulation of heart rate Biological Process GO:0042414 epinephrine metabolic process Biological Process GO:0042415 norepinephrine metabolic process Biological Process GO:0042417 dopamine metabolic process Biological Process GO:0045776 negative regulation of blood pressure Biological Process GO:0055062 phosphate ion homeostasis Biological Process GO:0060047 heart contraction Biological Process GO:0071869 response to catecholamine Biological Process GO:0071871 response to epinephrine Biological Process GO:0071873 response to norepinephrine Biological Process |
| KEGG gene cross-reference | hsa:55328 psp:PSPPH_1014 pst:PSPTO_1126 rno:361751 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01266DAO156-185 aaPF03486HI0933_like156-185 aaPF12831FAD_oxidored156-231 aaPF00890FAD_binding_2156-183 aaPF01494FAD_binding_3156-183 aaPF01946Thi4156-210 aaPF07992Pyr_redox_2156-185 aaPF00070Pyr_redox156-186 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G197250 | PF01266 | DAO | 156 | 185 | 2.3e-05 | 24.8 |
| TkA03G197250 | PF03486 | HI0933_like | 156 | 185 | 0.0015 | 18.8 |
| TkA03G197250 | PF12831 | FAD_oxidored | 156 | 231 | 0.0033 | 17.5 |
| TkA03G197250 | PF00890 | FAD_binding_2 | 156 | 183 | 0.0048 | 16.9 |
| TkA03G197250 | PF01494 | FAD_binding_3 | 156 | 183 | 0.0059 | 16.6 |
| TkA03G197250 | PF01946 | Thi4 | 156 | 210 | 0.015 | 15.3 |
| TkA03G197250 | PF07992 | Pyr_redox_2 | 156 | 185 | 0.037 | 14.2 |
| TkA03G197250 | PF00070 | Pyr_redox | 156 | 186 | 0.062 | 14.5 |
| TkA03G197250 | PF01134 | GIDA | 156 | 182 | 0.25 | 11.1 |
| TkA03G197250 | PF13450 | NAD_binding_8 | 158 | 224 | 6.4e-12 | 46.3 |
| TkA03G197250 | PF01593 | Amino_oxidase | 163 | 224 | 5.6e-05 | 23.3 |
| TkA03G197250 | PF01593 | Amino_oxidase | 249 | 375 | 5.6e-05 | 23.3 |
| TkA03G197250 | PF01266 | DAO | 278 | 315 | 2.3e-05 | 24.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.