TkA03G196870 | RubberDandelionOmics

Gene overview

TkA03G196870

Reference: TK1151 Chr: Chr03 Coordinates: 49408871-49409892 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · TkA03G196870|TK1151|cDNA

ATGGTTGGGCGTAATGAGGTTCATTCGGATTTGAATGGCGATAACGATAATTCAAACAACGAAAATTGTGATAACTTATCGGGAATGTTACACGATTGCGAGTATGACATTGCTAACGAGGACTATGACAAGTTTCAGGAGTTATTTAATGAATCACCTCTTTATAATCGATTCAGGAATGGTGTTACGGATGCTACGATTCACTCGCGGAAGGGAAGGGATACAGAACTACTAAATGGTGGCATGGTGGAAGAAGAAAC...

CDS

Download CDS FASTA

483 bp · TkA03G196870|TK1151|CDS

ATGGTTGGGCGTAATGAGGTTCATTCGGATTTGAATGGCGATAACGATAATTCAAACAACGAAAATTGTGATAACTTATCGGGAATGTTACACGATTGCGAGTATGACATTGCTAACGAGGACTATGACAAGTTTCAGGAGTTATTTAATGAATCACCTCTTTATAATCGATTCAGGAATGGTGTTACGGATGCTACGATTCACTCGCGGAAGGGAAGGGATACAGAACTACTAAATGGTGGCATGGTGGAAGAAGAAAC...

Protein

Download Protein FASTA

160 aa · TkA03G196870|TK1151|PROTEIN

MVGRNEVHSDLNGDNDNSNNENCDNLSGMLHDCEYDIANEDYDKFQELFNESPLYNRFRNGVTDATIHSRKGRDTELLNGGMVEEETLGATLHLSHKRETEKLRDRGARRDARLGFRLQGSGFWLQGLGFRLWALVVRVWALVFTVWALGFRVWALGFGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G196870`
TK1151 ID	TkA03G196870
OH-1004 ID	LXL04_015933
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 41.875 / OH-1004 9.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G196870`
Location	Chr03:49408871-49409892 (-)
Description	Similar to RRP46: Exosome complex exonuclease RRP46 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015933` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0016075 rRNA catabolic process Biological Process GO:0034475 U4 snRNA 3'-end processing Biological Process GO:0045006 DNA deamination Biological Process GO:0051607 defense response to virus Biological Process GO:0071028 nuclear mRNA surveillance Biological Process GO:0071051 poly(A)-dependent snoRNA 3'-end processing Biological Process GO:0000176 nuclear exosome (RNase complex) Cellular Component GO:0000177 cytoplasmic exosome (RNase complex) Cellular Component
KEGG gene cross-reference	ath:AT3G46210 dosa:Os03g0854200 hsa:56915 mmu:27998 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · TkA03G196870 · TK1151

Nucleus0.389

Rank 2 · TkA03G196870 · TK1151

Mitochondrion0.148

Rank 3 · TkA03G196870 · TK1151

Cell membrane0.105

Rank 4 · TkA03G196870 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA03G196870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card