TkA03G176320 | RubberDandelionOmics

Gene overview

TkA03G176320

Reference: TK1151 Chr: Chr03 Coordinates: 44466203-44468213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1556 bp · TkA03G176320|TK1151|cDNA

ATGCAACAAACCCATTTTTCTTCCGGCCCTTGTTTCCATACCATCTATATTTACTTCCACTCGAAAACCTATTCCTCTTTGCCCAAAACCCTAGCCCCCTCATTCCTTTCTGCACTCCGATCGCGCAGAAATGGCCGCCGCCCGTCCTCTCGTCACCGTCCAGTCCCTGGAGTCCGACATGGCCACCGACAGTGCAGGTATTCCTCTTCCCCAAGTCATGAAGGCTTCTATCCGGCCGGATATTGTCAATTTTGTCCACT...

CDS

Download CDS FASTA

1212 bp · TkA03G176320|TK1151|CDS

ATGGCCGCCGCCCGTCCTCTCGTCACCGTCCAGTCCCTGGAGTCCGACATGGCCACCGACAGTGCAGGTATTCCTCTTCCCCAAGTCATGAAGGCTTCTATCCGGCCGGATATTGTCAATTTTGTCCACTCTAATATCTCCAAAAACTCCCGTCAACCCTACGCCGTTTCCAGAAAGGCCGGCCACCAGACCTCCGCCGAGTCCTGGGGTACTGGTCGTGCAGTATCCCGTATTCCACGTGTTCCTGGTGGTGGAACTCA...

Protein

Download Protein FASTA

403 aa · TkA03G176320|TK1151|PROTEIN

MAAARPLVTVQSLESDMATDSAGIPLPQVMKASIRPDIVNFVHSNISKNSRQPYAVSRKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTRIWRRWHRKINVNQKRYAVVSAIAASAVPSLVMARGHRIESVPELPLVVSDSAEGVEKTQNAIKVLKQIGAFPDAEKAKDSVGIRPGVGKMRNRRYISRKGPLIVYGTEGAKLVKAFRNIPGVEIANVERLNLLKLAPGGHLGRFIIWTKSAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G176320`
TK1151 ID	TkA03G176320
OH-1004 ID	LXL04_032703
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.000
Protein coverage (%)	TK1151 99.752 / OH-1004 99.505 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G176320

Location Chr03:44466203-44468213 (-)

Description Similar to RPL4A: 60S ribosomal protein L4-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09630`	Large ribosomal subunit protein uL4z.	No verified direct reference in this release
`At5g02870`	Large ribosomal subunit protein uL4y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032703 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

KEGG gene cross-reference

ath:AT3G09630

ath:AT5G02870

spo:2539780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.807

Rank 1 · TkA03G176320 · TK1151

Nucleus0.192

Rank 2 · TkA03G176320 · TK1151

Mitochondrion0.067

Rank 3 · TkA03G176320 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA03G176320 · TK1151

Plastid0.026

Rank 5 · TkA03G176320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00573Ribosomal_L425-265 aa

PF14374Ribos_L4_asso_C279-351 aa

PF29082PEA2_middle309-336 aa

PF14374Ribos_L4_asso_C350-366 aa

PF29082PEA2_middle352-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G176320	`PF00573`	Ribosomal_L4	25	265	7.2e-36	124.3
TkA03G176320	`PF14374`	Ribos_L4_asso_C	279	351	1.6e-28	99.2
TkA03G176320	`PF29082`	PEA2_middle	309	336	0.44	11.5
TkA03G176320	`PF14374`	Ribos_L4_asso_C	350	366	1.6e-28	99.2
TkA03G176320	`PF29082`	PEA2_middle	352	384	0.44	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF40`	Arabidopsis thaliana	sp\|Q9SF40\|RL4A_ARATH Large ribosomal subunit protein uL4z	80.600%	Swiss-Prot	High
`P49691`	Arabidopsis thaliana	sp\|P49691\|RL4B_ARATH Large ribosomal subunit protein uL4y	80.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card