RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032703
Reference: OH-1004 Chr: Chr07 Coordinates: 28073112-28074554 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1215 bp · LXL04_032703|LXL04_032703|OH1004|cDNA

ATGGCCGCCGCAGCCCGTCCTCTCGTCACCGTCCAGGCGCTCGAATCCGATATGGCTACCGACGGCGCCTCACTGCCCCTTCCAGAGGTCATGAAAGCATCGATTCGTCCCGACATTGTCAACTTCGTTCATTCCAACATCTCTAAGAACTCCCGCCAGCCTTACGCCGTCTCCAGACAAGCTGGTCACCAGACCTCAGCTGAGTCATGGGGTACCGGACGTGCTGTGTCTCGTATCCCTCGTGTCTCTGGAGGTGGTAC...

CDS

Download CDS FASTA

1215 bp · LXL04_032703|LXL04_032703|OH1004|CDS

ATGGCCGCCGCAGCCCGTCCTCTCGTCACCGTCCAGGCGCTCGAATCCGATATGGCTACCGACGGCGCCTCACTGCCCCTTCCAGAGGTCATGAAAGCATCGATTCGTCCCGACATTGTCAACTTCGTTCATTCCAACATCTCTAAGAACTCCCGCCAGCCTTACGCCGTCTCCAGACAAGCTGGTCACCAGACCTCAGCTGAGTCATGGGGTACCGGACGTGCTGTGTCTCGTATCCCTCGTGTCTCTGGAGGTGGTAC...

Protein

Download Protein FASTA

404 aa · LXL04_032703|LXL04_032703|OH1004|PROTEIN

MAAAARPLVTVQALESDMATDGASLPLPEVMKASIRPDIVNFVHSNISKNSRQPYAVSRQAGHQTSAESWGTGRAVSRIPRVSGGGTHRAGQGAFGNMCRGGRMFAPTRIWRRWHRKINVNQKRYAVVSAIAASCVPSLVMARGHRIESVPELPLVVSDSAEGVEKTQNAIKVLKQIGAYPDAEKAKDSLGIRPGKGKMRNRRYIARKGPLIVYGTEGAKLVKAFRNIPGVEIANVERLNLLKLAPGGHLGRFIIWTKSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032703
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032703
LocationChr07:28073112-28074554 (-)
DescriptionSimilar to RPL4A: 60S ribosomal protein L4-1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g09630 Large ribosomal subunit protein uL4z. No verified direct reference in this release
At5g02870 Large ribosomal subunit protein uL4y. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032703 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0002181 cytoplasmic translation Biological Process
GO:0006412 translation Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005840 ribosome Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009505 plant-type cell wall Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0022625 cytosolic large ribosomal subunit Cellular Component
KEGG gene cross-reference
ath:AT3G09630
ath:AT5G02870
spo:2539780
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.828
Rank 1 · LXL04_032703 · OH-1004
Nucleus0.194
Rank 2 · LXL04_032703 · OH-1004
Endoplasmic reticulum0.062
Rank 3 · LXL04_032703 · OH-1004
Mitochondrion0.057
Rank 4 · LXL04_032703 · OH-1004
Plastid0.019
Rank 5 · LXL04_032703 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00573.28Ribosomal_L427-266 aa
PF14374.12Ribos_L4_asso_C280-352 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_032703PF00573.28Ribosomal_L4272667e-36124.4
LXL04_032703PF14374.12Ribos_L4_asso_C2803523e-29101.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SF40Arabidopsis thalianaLarge ribosomal subunit protein uL4z81.188%Swiss-Protstrong database homology
P49691Arabidopsis thalianaLarge ribosomal subunit protein uL4y79.950%Swiss-Protstrong database homology

JBrowse

View in Genome Browser