Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5356 bp · TkA03G166050|TK1151|cDNA
AAATGAACCAAACCCCATGGATCGAACTTGGCTCGGTTCGCTTCAGGCCTCGACTCGTTGATGGCGCGCTTCTGCACGGCACACGTGCATAGCAACTAGACAAAACTGGTTTTTCTCTTGCTTCGCCATTACTGACTCTGATACTAAGAAGATCTGTAAGCGAAAAATCTGAGCTCAAGATTTCGATCGGTCGAATCAACCACAGAGACATATGTTTGAATAGAGAAATAGAGGAAGGGGATGGCTTTCATGGCGGTTTT...
4854 bp · TkA03G166050|TK1151|CDS
ATGGCTTTCATGGCGGTTTTGGAGTCAGATCTACGCGCCCTCTCCGCCGAAGCACGCCGTAGGTACCCCGCCATCAAAGACGGAGCAGAGCACGCTATCTTGAAGCTCCGGTCCTTGTCAAGTTCTAGTGAAATTGCACAGCATGATGATATTCTGAGGATATTTTTGATGGCATGCGAAGTTAAGACAGTTAAACTGAGTGTCATTGGTTTATCCTGCTTGCAAAAGCTCATAGCACATGATGCTGTATCCCCTTCAGC...
Protein
Download Protein FASTA1617 aa · TkA03G166050|TK1151|PROTEIN
MAFMAVLESDLRALSAEARRRYPAIKDGAEHAILKLRSLSSSSEIAQHDDILRIFLMACEVKTVKLSVIGLSCLQKLIAHDAVSPSALNEILATLKDHGEMADEGVQLKTLQTVLIIFQSRLQPDGEEHTAQALGICLHLLENNKSSDSVRNTAAATFRQAVALIFDHVVSSESLPSVKSVLGGYMSRSSSVSSDINHSIKYSKSMEEGLMSLDKSKMRENPTKAGKLGLRLLEDLTALAAGGSAIWLRVGSIQRAFALD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G166050 |
|---|---|
| TK1151 ID | TkA03G166050 |
| OH-1004 ID | LXL04_007413 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G166050 |
|---|---|
| Location | Chr03:42078778-42092311 (-) |
| Description | Similar to mon2: Protein MON2 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006623 protein targeting to vacuole Biological Process GO:0006895 Golgi to endosome transport Biological Process GO:0015031 protein transport Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:1905279 regulation of retrograde transport, endosome to Golgi Biological Process GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0031901 early endosome membrane Cellular Component GO:0036019 endolysosome Cellular Component |
| KEGG gene cross-reference | dme:Dmel_CG8683 dpo:4816705 hsa:23041 xla:444214 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16213DCB3-170 aaPF25780TPR_IPO5115-163 aaPF03810IBN_N129-167 aaPF00514Arm133-156 aaPF02985HEAT139-160 aaPF13513HEAT_EZ146-160 aaPF12783Sec7-like_HUS231-386 aaPF09324Sec7-like_HDS305-340 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G166050 | PF16213 | DCB | 3 | 170 | 5.4e-40 | 137.7 |
| TkA03G166050 | PF25780 | TPR_IPO5 | 115 | 163 | 0.0031 | 18.5 |
| TkA03G166050 | PF03810 | IBN_N | 129 | 167 | 0.062 | 14.0 |
| TkA03G166050 | PF00514 | Arm | 133 | 156 | 0.42 | 11.5 |
| TkA03G166050 | PF02985 | HEAT | 139 | 160 | 0.0028 | 18.5 |
| TkA03G166050 | PF13513 | HEAT_EZ | 146 | 160 | 0.00062 | 21.0 |
| TkA03G166050 | PF12783 | Sec7-like_HUS | 231 | 386 | 2.7e-22 | 80.0 |
| TkA03G166050 | PF09324 | Sec7-like_HDS | 305 | 340 | 5.3e-09 | 36.6 |
| TkA03G166050 | PF13646 | HEAT_2 | 382 | 420 | 0.18 | 12.8 |
| TkA03G166050 | PF00514 | Arm | 388 | 414 | 0.42 | 11.5 |
| TkA03G166050 | PF23325 | TPR_28 | 492 | 534 | 7.5e-07 | 29.9 |
| TkA03G166050 | PF09324 | Sec7-like_HDS | 497 | 522 | 5.3e-09 | 36.6 |
| TkA03G166050 | PF16213 | DCB | 570 | 600 | 5.4e-40 | 137.7 |
| TkA03G166050 | PF00514 | Arm | 597 | 606 | 0.42 | 11.5 |
| TkA03G166050 | PF09324 | Sec7-like_HDS | 599 | 627 | 5.3e-09 | 36.6 |
| TkA03G166050 | PF10041 | DUF2277 | 633 | 689 | 0.22 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.