LXL04_007413 | RubberDandelionOmics

Gene overview

LXL04_007413

Reference: OH-1004 Chr: Chr02 Coordinates: 46966725-46979545 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4854 bp · LXL04_007413|LXL04_007413|OH1004|cDNA

ATGGCTTTCATGGCGGTTTTGGAGTCAGATCTACGCGCCCTCTCCGCCGAAGCACGCCGTAGGTACCCCGCCATCAAAGACGGAGCAGAACACGCTATCTTGAAGCTCCGGTCCTTGTCAAGTTCTAGTGAAATTGCACAGCATGATGATATTCTGAGGATATTTTTGATGGCATGTGAAGTTAAGACAGTTAAGCTGAGTGTCATTGGTTTATCCTGCTTGCAAAAGCTCATAGCACATGATGCTGTATCCCCTTCAGC...

CDS

Download CDS FASTA

4854 bp · LXL04_007413|LXL04_007413|OH1004|CDS

ATGGCTTTCATGGCGGTTTTGGAGTCAGATCTACGCGCCCTCTCCGCCGAAGCACGCCGTAGGTACCCCGCCATCAAAGACGGAGCAGAACACGCTATCTTGAAGCTCCGGTCCTTGTCAAGTTCTAGTGAAATTGCACAGCATGATGATATTCTGAGGATATTTTTGATGGCATGTGAAGTTAAGACAGTTAAGCTGAGTGTCATTGGTTTATCCTGCTTGCAAAAGCTCATAGCACATGATGCTGTATCCCCTTCAGC...

Protein

Download Protein FASTA

1617 aa · LXL04_007413|LXL04_007413|OH1004|PROTEIN

MAFMAVLESDLRALSAEARRRYPAIKDGAEHAILKLRSLSSSSEIAQHDDILRIFLMACEVKTVKLSVIGLSCLQKLIAHDAVSPSALNEILATLKDHGEMADEGVQLKTLQTVLIIFQSRLQPDGEEHTAQALGICLHLLENNKSSDSVRNTAAATFRQAVALIFDHVVSSESLPSVKSVLGGYMSRSSSVSSDINHSIKYSKSMEEGLMSLDKSKMRENPTKAGKLGLRLLEDLTALAAGGSAIWLRVGSIQRAFALD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007413`
TK1151 ID	TkA03G166050
OH-1004 ID	LXL04_007413
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_007413`
Location	Chr02:46966725-46979545 (-)
Description	Similar to mon2: Protein MON2 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007413` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006623 protein targeting to vacuole Biological Process GO:0006895 Golgi to endosome transport Biological Process GO:0015031 protein transport Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:1905279 regulation of retrograde transport, endosome to Golgi Biological Process GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0031901 early endosome membrane Cellular Component GO:0036019 endolysosome Cellular Component
KEGG gene cross-reference	dme:Dmel_CG8683 dpo:4816705 hsa:23041 xla:444214 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.528

Rank 1 · LXL04_007413 · OH-1004

Golgi apparatus0.366

Rank 2 · LXL04_007413 · OH-1004

Nucleus0.167

Rank 3 · LXL04_007413 · OH-1004

Cell membrane0.136

Rank 4 · LXL04_007413 · OH-1004

Lysosome / Vacuole0.100

Rank 5 · LXL04_007413 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16213.12DCB3-170 aa

PF12783.14Sec7-like_HUS231-386 aa

PF09324.16Sec7-like_HDS797-862 aa

PF16206.10Mon2_C868-1156 aa

PF16206.10Mon2_C1286-1545 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007413	`PF16213.12`	DCB	3	170	3.2e-40	138.4
LXL04_007413	`PF12783.14`	Sec7-like_HUS	231	386	2.7e-22	80.1
LXL04_007413	`PF09324.16`	Sec7-like_HDS	797	862	5.5e-09	36.5
LXL04_007413	`PF16206.10`	Mon2_C	868	1156	4.4e-59	201.2
LXL04_007413	`PF16206.10`	Mon2_C	1286	1545	4.4e-59	201.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card