TkA03G157170 | RubberDandelionOmics

Gene overview

TkA03G157170

Reference: TK1151 Chr: Chr03 Coordinates: 39853595-39856747 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1748 bp · TkA03G157170|TK1151|cDNA

AAATAAGTGTAACTACAGGGGCCGTTTGCTCAAATCTGTGTTGAATAACAGGTCAATGCTTAAAGCCCCAACACTACTACACGGTGGTTAGGATCCAAACCTCAAGAACCCTAAAACCAAAGGAAGATAACATGGCGAATTTCTCCATCGCCACCGTCTTCATTGCCTCGATCTCACTGTTACTCGCACTCACCCACTCATTTTCTATCGAGAACCCTACAGATCGGCGCATTTTAGTGTTGGTCGACGACTTGGCTCTC...

CDS

Download CDS FASTA

1317 bp · TkA03G157170|TK1151|CDS

ATGGCGAATTTCTCCATCGCCACCGTCTTCATTGCCTCGATCTCACTGTTACTCGCACTCACCCACTCATTTTCTATCGAGAACCCTACAGATCGGCGCATTTTAGTGTTGGTCGACGACTTGGCTCTCAAGTCTTCGCACTCGATCTTCTTCAGCTCATTACAGGCACGTGGATTTGAGCTCGATTTCAAGCTCTCAGATGATCCCAAGATCTCGCTTCAGAGATACGGGCAACATTTATATGATGGCCTGATTCTGTT...

Protein

Download Protein FASTA

438 aa · TkA03G157170|TK1151|PROTEIN

MANFSIATVFIASISLLLALTHSFSIENPTDRRILVLVDDLALKSSHSIFFSSLQARGFELDFKLSDDPKISLQRYGQHLYDGLILFSPTTERFGGSLDVAAILDFVDSGKDLIVAADANASDLIRNIAAECGIDFDEDQSAVVIDHGSYAVSETEGDHTLIAADDLIQSDVLLGSTKIEAPVLFKGIGHSLNPANSLVVKVLSASPSAYSANPKSKLSTPPSLSGSSISLVSVVQARNNARVVFSGSLDLFSNKFFKSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G157170`
TK1151 ID	TkA03G157170
OH-1004 ID	LXL04_007327
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G157170

Location Chr03:39853595-39856747 (+)

Description Similar to OST48: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66680`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	Mutants in DEFECTIVE GLYCOSYLATION, an Arabidopsis homolog of an oligosaccharyltransferase complex subunit, show protein underglycosylation and defects in cell differentiation and growth.2005 · DOI: 10.1111/j.1365-313x.2005.02392.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0209000`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007327 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0034097 response to cytokine Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT5G66680

dosa:Os07g0209000

mmu:13200

xla:444283

xtr:100145597

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.870

Rank 1 · TkA03G157170 · TK1151

Nucleus0.081

Rank 2 · TkA03G157170 · TK1151

Cytoplasm0.080

Rank 3 · TkA03G157170 · TK1151

Golgi apparatus0.067

Rank 4 · TkA03G157170 · TK1151

Lysosome / Vacuole0.054

Rank 5 · TkA03G157170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03345OST48_N30-289 aa

PF09822ABC_transp_aux72-124 aa

PF14258DUF435095-259 aa

PF09822ABC_transp_aux198-280 aa

PF23358OST48_MD300-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G157170	`PF03345`	OST48_N	30	289	3.2e-77	260.1
TkA03G157170	`PF09822`	ABC_transp_aux	72	124	0.0011	19.0
TkA03G157170	`PF14258`	DUF4350	95	259	0.026	15.5
TkA03G157170	`PF09822`	ABC_transp_aux	198	280	0.0011	19.0
TkA03G157170	`PF23358`	OST48_MD	300	438	1.2e-48	165.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944K2`	Arabidopsis thaliana	sp\|Q944K2\|OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit	75.600%	Swiss-Prot	High
`Q6ZLK0`	Oryza sativa subsp. japonica	sp\|Q6ZLK0\|OST48_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit	77.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card