TkA03G127700 | RubberDandelionOmics

Gene overview

TkA03G127700

Reference: TK1151 Chr: Chr03 Coordinates: 32775547-32785544 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2873 bp · TkA03G127700|TK1151|cDNA

GAAGTTTTGGAATTAAACTGATAAAATCGGAAGCGCCTCTTTCTCCTTCGTCTCCTTCACCCGACAATCATCGCGAGGACTTCAAATACCCCGATCGGACTTCATCGCGAGGAGAGAAATCACGCAGGAAGGGTGGACGAGCCTGGACGGAACCGGCGAGTGAGGCAGAAAGGGATAACGGCGGAGACGGGAGCCGCGACCACCGGCGCAGCGAGGACCTCCGCAGATCGGCGCTGCAATCGATCGGCAATCACCTCCGG...

CDS

Download CDS FASTA

1776 bp · TkA03G127700|TK1151|CDS

ATGGCTCAGATTCCCAATTTACAGAACGGACCTATCAATTTCACTCCTATAAGAGATCAGTCTCAGAAGGAGCTCATAACAATCCTTAAAAATATTCGAGGAAAAAAATGCTTGGTGATCGATCCGAAGCTGGGTGGTTCCCTATCATTGATCGTCCAGACTTCAGTCCTCAAGGAACATGGAGCTGAATTGCATCATCTTAATGAAGATCCACTGGAAACCGCCTGTACAAAAGTGGTGTACCTTGTTCAAACCCAGCT...

Protein

Download Protein FASTA

591 aa · TkA03G127700|TK1151|PROTEIN

MAQIPNLQNGPINFTPIRDQSQKELITILKNIRGKKCLVIDPKLGGSLSLIVQTSVLKEHGAELHHLNEDPLETACTKVVYLVQTQLHLMKFISSHIHNDTSKGLQREYFLYFVPRRAVACEKLLEDEKVHNLLTIGEFPLYAVPLDEDILSFELDLSYKECLTDGDTTSLWHIAKGIHKLEFSFGLIPNVRAKGKASVRVADMLNRMQAEEPVSSTDTGVPEINTLIILDRELDMVTPMCTQLTYEGLLDEFLHVDNGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G127700`
TK1151 ID	TkA03G127700
OH-1004 ID	LXL04_031497
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.300
Protein coverage (%)	TK1151 38.409 / OH-1004 96.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G127700

Location Chr03:32775547-32785544 (+)

Description Similar to VPS33: Vacuolar protein-sorting-associated protein 33 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54860`	Involved in regulating membrane fusion at the tonoplast and the prevacuolar compartment.	The AtC-VPS protein complex is localized to the tonoplast and the prevacuolar compartment in arabidopsis.2003 · DOI: 10.1091/mbc.e02-08-0509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031497 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006622 protein targeting to lysosome Biological Process

GO:0006727 ommochrome biosynthetic process Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0007032 endosome organization Biological Process

GO:0007033 vacuole organization Biological Process

GO:0007220 Notch receptor processing Biological Process

GO:0008057 eye pigment granule organization Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0008340 determination of adult lifespan Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0016192 vesicle-mediated transport Biological Process

KEGG gene cross-reference

ath:AT3G54860

dme:Dmel_CG12230

hsa:65082

mmu:77573

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.688

Rank 1 · TkA03G127700 · TK1151

Golgi apparatus0.213

Rank 2 · TkA03G127700 · TK1151

Lysosome / Vacuole0.137

Rank 3 · TkA03G127700 · TK1151

Nucleus0.127

Rank 4 · TkA03G127700 · TK1151

Cell membrane0.093

Rank 5 · TkA03G127700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00156Pribosyltran27-63 aa

PF00995Sec136-584 aa

PF00156Pribosyltran192-225 aa

PF09840DUF2067284-349 aa

PF27937CBARP304-394 aa

PF00156Pribosyltran542-562 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G127700	`PF00156`	Pribosyltran	27	63	0.086	12.9
TkA03G127700	`PF00995`	Sec1	36	584	3e-117	393.9
TkA03G127700	`PF00156`	Pribosyltran	192	225	0.086	12.9
TkA03G127700	`PF09840`	DUF2067	284	349	0.063	13.6
TkA03G127700	`PF27937`	CBARP	304	394	0.19	11.0
TkA03G127700	`PF00156`	Pribosyltran	542	562	0.086	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KJ7`	Arabidopsis thaliana	sp\|Q94KJ7\|VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card