TkA03G126950 | RubberDandelionOmics

Gene overview

TkA03G126950

Reference: TK1151 Chr: Chr03 Coordinates: 32540771-32541533 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · TkA03G126950|TK1151|cDNA

ATGGCTAGCAAAGAGCTCCAACGGTCACAATTTCAATTGGCAATCCCTCGTCGATTAGGAAATGCCGCCGGCAAAAAAGAGGAAACGGGGCGGTGTTTGCCGCCGGCAAACATTGCCAAATCAGCAATGCCGCCGGCATTAAACGCCCACACCGTGCAGTCTAATGACTTTGAAACAACTGATTGTATGAGAGTCCGAATCACCGATGCTAAGCACAAAAGATGGGAAATTCCAGTCCACGTCCTTCCACGCCAATCACG...

CDS

Download CDS FASTA

606 bp · TkA03G126950|TK1151|CDS

ATGGCTAGCAAAGAGCTCCAACGGTCACAATTTCAATTGGCAATCCCTCGTCGATTAGGAAATGCCGCCGGCAAAAAAGAGGAAACGGGGCGGTGTTTGCCGCCGGCAAACATTGCCAAATCAGCAATGCCGCCGGCATTAAACGCCCACACCGTGCAGTCTAATGACTTTGAAACAACTGATTGTATGAGAGTCCGAATCACCGATGCTAAGCACAAAAGATGGGAAATTCCAGTCCACGTCCTTCCACGCCAATCACG...

Protein

Download Protein FASTA

201 aa · TkA03G126950|TK1151|PROTEIN

MASKELQRSQFQLAIPRRLGNAAGKKEETGRCLPPANIAKSAMPPALNAHTVQSNDFETTDCMRVRITDAKHKRWEIPVHVLPRQSRTFDFPAEPNYQQIPSEILFSDPTSDLILNLHNTTTGTTTQFGFTITRRSSGDILFDTSGTVLVFKDQYLELTSSLPANRSSIYGLGEHTKRSFKLTHNQTLTPGPAQEGFNMFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G126950`
TK1151 ID	TkA03G126950
OH-1004 ID	LXL04_007140
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.000
Protein coverage (%)	TK1151 66.169 / OH-1004 14.602 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G126950

Location Chr03:32540771-32541533 (+)

Description Similar to Alpha-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68560`	Glycoside hydrolase releasing xylosyl residues from xyloglucan oligosaccharides at the non-reducing end.	AXY3 encodes a α-xylosidase that impacts the structure and accessibility of the hemicellulose xyloglucan in Arabidopsis plant cell walls.2011 · DOI: 10.1007/s00425-010-1330-7

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0675700`	Probable alpha-glucosidase Os06g0675700.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007140 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0045493 xylan catabolic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

KEGG gene cross-reference

ath:AT1G68560

dosa:Os06g0675700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.613

Rank 1 · TkA03G126950 · TK1151

Cytoplasm0.178

Rank 2 · TkA03G126950 · TK1151

Nucleus0.091

Rank 3 · TkA03G126950 · TK1151

Endoplasmic reticulum0.080

Rank 4 · TkA03G126950 · TK1151

Lysosome / Vacuole0.048

Rank 5 · TkA03G126950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13802Gal_mutarotas_284-178 aa

PF13468Glyoxalase_3117-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G126950	`PF13802`	Gal_mutarotas_2	84	178	0.0053	17.8
TkA03G126950	`PF13468`	Glyoxalase_3	117	182	0.23	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7Y7`	Arabidopsis thaliana	sp\|Q9S7Y7\|XYL1_ARATH Alpha-xylosidase 1	39.100%	Swiss-Prot	Medium
`Q653V7`	Oryza sativa subsp. japonica	sp\|Q653V7\|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700	50.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card