TkA03G125360 | RubberDandelionOmics

Gene overview

TkA03G125360

Reference: TK1151 Chr: Chr03 Coordinates: 32181501-32182056 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · TkA03G125360|TK1151|cDNA

ATGAGAATGGCGACAGATGTGCTTGGAAAAGCTGCATTTGGGTTTGACTTTGGTCTCTCTAAACCTAAAAATCATCAGGACAACGATGAACAAATCGACTCATTCGTCAAGCAACATATATACTCCACAAAGATGCTGAAAATGGACTTGTCGGCCTCGTTTTCAATCATTCTAGGGCTCCTTCTCCCAATCCTCCAAGAGCCCTTTCGCCAGATACTCAAGCGAATTCTGTACACCATAAATTGGAATTTTGAAAAAAA...

CDS

Download CDS FASTA

462 bp · TkA03G125360|TK1151|CDS

ATGAGAATGGCGACAGATGTGCTTGGAAAAGCTGCATTTGGGTTTGACTTTGGTCTCTCTAAACCTAAAAATCATCAGGACAACGATGAACAAATCGACTCATTCGTCAAGCAACATATATACTCCACAAAGATGCTGAAAATGGACTTGTCGGCCTCGTTTTCAATCATTCTAGGGCTCCTTCTCCCAATCCTCCAAGAGCCCTTTCGCCAGATACTCAAGCGAATTCTGTACACCATAAATTGGAATTTTGAAAAAAA...

Protein

Download Protein FASTA

153 aa · TkA03G125360|TK1151|PROTEIN

MRMATDVLGKAAFGFDFGLSKPKNHQDNDEQIDSFVKQHIYSTKMLKMDLSASFSIILGLLLPILQEPFRQILKRILYTINWNFEKNKHELEQSISNRTGFNFMDGIIRISECFETQSLHLAQIAEKSESQEVNSPAFRITAVVPEEYKPNRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G125360`
TK1151 ID	TkA03G125360
OH-1004 ID	LXL04_005583
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.200
Protein coverage (%)	TK1151 62.092 / OH-1004 18.095 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G125360

Location Chr03:32181501-32182056 (+)

Description Similar to CYP711A1: Cytochrome P450 711A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26170`	Involved in the biosynthesis of strigolactone natural products, bioactive compounds promoting plant fitness and soil microbe interactions, but preventing shoot branching.	MAX1 encodes a cytochrome P450 family member that acts downstream of MAX3/4 to produce a carotenoid-derived branch-inhibiting hormone.2005 · DOI: 10.1016/j.devcel.2005.01.009 MAX1, a regulator of the flavonoid pathway, controls vegetative axillary bud outgrowth in Arabidopsis.2006 · DOI: 10.1073/pnas.0509463102 Carlactone is converted to carlactonoic acid by MAX1 in Arabidopsis and its methyl ester can directly interact with AtD14 in vitro.2014 · DOI: 10.1073/pnas.1410801111 Hydroxyl carlactone derivatives are predominant strigolactones in Arabidopsis .2020 · DOI: 10.1002/pld3.219

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005583 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006690 icosanoid metabolic process Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0030644 intracellular chloride ion homeostasis Biological Process

GO:0045471 response to ethanol Biological Process

GO:0045907 positive regulation of vasoconstriction Biological Process

GO:0046457 prostanoid biosynthetic process Biological Process

GO:0070542 response to fatty acid Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G26170

hsa:6916

rno:24886

ssc:397112

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.403

Rank 1 · TkA03G125360 · TK1151

Cytoplasm0.154

Rank 2 · TkA03G125360 · TK1151

Peroxisome0.142

Rank 3 · TkA03G125360 · TK1151

Endoplasmic reticulum0.117

Rank 4 · TkA03G125360 · TK1151

Nucleus0.106

Rank 5 · TkA03G125360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DFU2`	Arabidopsis thaliana	sp\|B9DFU2\|MAX1_ARATH Cytochrome P450 711A1	54.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card